KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0757Help
Entry
NMB0757           CDS       T00027                                 

Gene name
hemH
Definition
(RefSeq) phosphoribosylaminoimidazole-succinocarboxamide synthase
  KO
K01923  phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00230  Purine metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
Module
nme_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMB0757 (hemH)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     NMB0757 (hemH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAICAR_synt
Motif
Other DBs
NCBI-GeneID: 902872
NCBI-ProteinID: NP_273799
UniProt: Q9K063
Position
784636..785499
Genome map
AA seq 287 aa AA seqDB search
MSEIGLVKIYFGKVRDLYEIDDKRMLMVASDRLSAFDVILDDPIPSKGEILTQISNFWFK
KLAHIMPNHFTGQTVYDVLPENEAKALEKRAVVAKKLTPVKVEAIVRGYLAGSGWKDYQK
TGSVCGIQLPEGMQEAQQLPEVIFTPSTKAAVGDHDENISFEECGRIIGKELAEEVRAKA
VRLYTEAAEYAKSRGIIICDTKFEFGLDENGTLTLMDEVLTPDSSRFWPADQYKVGTNPP
SFDKQFVRDWLEQSGWNKKAPAPKVPADVIQKTVEKYREALTLLTQD
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagattggtttggtaaagatctattttggaaaagtgcgcgatttatatgaaatc
gacgataaacgtatgctgatggtcgcttccgaccgcctgtccgcgtttgatgtgattttg
gacgacccgattccgagcaaaggggagattctgacgcagatttccaatttttggtttaaa
aaactggcgcatattatgcccaaccactttaccggtcaaacggtttacgatgttttgcct
gaaaacgaagccaaagctttagagaaacgcgccgtcgtggctaaaaagctcactccggtg
aaagtagaggcgattgtgcgtggttatctggcaggcagcggttggaaagattatcaaaaa
accggctcggtttgcggtattcaactgcctgaaggtatgcaggaagcgcaacaactgcct
gaagtgatttttacgccctcaaccaaagccgcagtcggcgatcacgatgaaaacatcagc
tttgaagaatgcggacgcattatcggcaaagaattggcggaagaagtgcgcgccaaggcg
gttcggctttacaccgaagcggcggaatatgccaaatcgcgcggtattattatttgcgat
accaaatttgaattcggtttggatgaaaacggtacgctgacgctgatggatgaggtattg
actcccgattcgagccgtttttggcctgccgaccaatacaaagtcggcaccaatccgccg
tcttttgacaaacaattcgtccgcgactggctggaacaaagcggttggaacaaaaaagcc
cctgcgccgaaagtgcctgccgatgtgattcagaaaactgtcgagaagtatcgggaagca
ttgactttgctgactcaggattga

DBGET integrated database retrieval system