KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0774Help
Entry
NMB0774           CDS       T00027                                 

Gene name
upp
Definition
(RefSeq) uracil phosphoribosyltransferase
  KO
K00761  uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00240  Pyrimidine metabolism
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    NMB0774 (upp)
Enzymes [BR:nme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     NMB0774 (upp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPRTase Pribosyltran BAAT_C
Motif
Other DBs
NCBI-GeneID: 902889
NCBI-ProteinID: NP_273816
UniProt: Q9K048
Position
801153..801779
Genome map
AA seq 208 aa AA seqDB search
MNVNVINHPLVRHKLTLMREADCSTYKFRTLATELARLMAYEASRDFEIEKYLIDGWCGQ
IEGDRIKGKTLTVVPILRAGLGMLDGVLDLIPTAKISVVGLQRDEETLKPISYFEKFVDS
MDERPALIIDPMLATGGSMVATIDLLKAKGCKNIKALVLVAAPEGVKAVNDAHPDVTIYT
AALDSHLNENGYIIPGLGDAGDKIFGTR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttaatgttatcaaccatccgctcgtccgccacaaattaaccctgatgagggag
gcggattgcagcacctacaaattccggacgcttgccaccgagctggcgcgcctgatggca
tacgaggcaagccgtgattttgaaatcgaaaaataccttatcgacggatggtgcggtcag
attgaaggcgaccgcatcaagggcaaaacattgaccgtcgttcccatactgcgtgcaggt
ttgggtatgcttgacggtgtgctcgacctgattccgactgccaaaatcagtgtagtcgga
ctgcagcgcgacgaagaaacgctgaagcctatttcctattttgagaaatttgtggacagt
atggacgaacgtccggctttgattatcgatcctatgctggcgacaggcggttcgatggtt
gccaccatcgaccttttgaaagccaagggctgcaaaaatatcaaggcactggtgctggtt
gccgcgcccgagggtgtgaaggcggtcaacgacgcgcaccctgacgttacgatttacacc
gccgcgctcgacagccacttgaacgagaacggctacatcatccccggcttgggcgatgcg
ggcgacaagattttcggcacgcgctaa

DBGET integrated database retrieval system