KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0802Help
Entry
NMB0802           CDS       T00027                                 

Gene name
metB
Definition
(RefSeq) cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00270  Cysteine and methionine metabolism
nme00450  Selenocompound metabolism
nme00920  Sulfur metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    NMB0802 (metB)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB0802 (metB)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NMB0802 (metB)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     NMB0802 (metB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 902917
NCBI-ProteinID: NP_273844
UniProt: Q9K024
Position
complement(828295..829452)
Genome map
AA seq 385 aa AA seqDB search
MKFATKAIHSSYDCDEHNRALMPPIYQNSMFALHEIGENVPYRYSRLSNPTRQILEDTVA
DLEHGAAGFAFSSGMAGIDAVWRTFLRPGDTIVAVADIYGGAYDLLVDVYQKWGVNVVFA
DLGNPDNLDELLKAHKVKLVWLETPSNPLLRLVDIKVLAAKAKAAGALVGIDNTFATPYL
QQPLDMGCDFVFHSATKYLCGHSDVLMGIVVAKTKELAQPLHDMMVHTGAVAGPLDCWLV
LRGIKTLALRMNAHCQNALEIARRLEAHPAIEKVFHPGLPSHEHYELAKTQMPKGIGGVV
TVYLKNDTREAANSVIKNMKLVKMASSLGGVESLVNHCYSQSHSGVPHDVKMEMGIKVGL
LRFSIGIEDADDIWNDISAALDTTL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcgccacgaaagccattcattccagctacgattgcgacgaacacaaccgcgcg
ctgatgccgccgatttatcaaaacagtatgtttgcgttgcacgagattggcgaaaatgtg
ccttaccgttattcgcgcctgagcaacccgacccgtcagattttagaagacaccgttgcc
gatttggaacacggtgcggcaggttttgcgttttccagcggtatggcgggaattgatgcc
gtatggcgcactttcctgcgcccgggcgataccattgtcgccgtcgccgatatttacggc
ggcgcttatgatttattggtcgatgtttatcaaaaatggggggtgaacgttgtttttgcc
gatttaggcaatccggataatttggacgaactgcttaaagcgcacaaggtcaaactggtt
tggctggaaacgccgtccaatccacttttacgcttggtagacatcaaagtccttgccgca
aaagccaaagcagccggtgcgctggtcggtatcgacaacacttttgccacgccgtatctg
caacagccgttggatatgggttgcgattttgtattccattccgctaccaaatatttgtgc
ggccattccgacgtgttgatgggcatcgtcgttgccaaaaccaaagaactggcgcagcct
ttgcacgatatgatggtgcataccggcgcggttgccggcccgctggactgctggctggtg
ttgcgcggcatcaaaacactggctctgcgcatgaacgcccattgccaaaacgcactcgaa
atcgcgcgccgtttggaagcccatcctgccattgaaaaagtgttccatcccggcctgccg
tctcacgaacattacgaactggcgaaaacacaaatgcccaaaggcatcggcggcgtggtt
acggtttatctcaaaaacgacacgcgtgaagcggcaaacagcgtgattaaaaacatgaaa
ctggtcaaaatggcttccagcctcggcggtgtggaaagtttggtcaaccattgctattcc
cagtcccacagcggcgtaccgcatgatgtgaaaatggaaatgggcatcaaagtcggtctg
ctgcgtttctccatcggcatcgaagacgcggacgatatttggaacgatatttccgccgca
ctcgatacaactttgtaa

DBGET integrated database retrieval system