KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0811Help
Entry
NMB0811           CDS       T00027                                 

Gene name
murB
Definition
(RefSeq) UDP-N-acetylenolpyruvoylglucosamine reductase
  KO
K00075  UDP-N-acetylmuramate dehydrogenase [EC:1.3.1.98]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00520  Amino sugar and nucleotide sugar metabolism
nme00550  Peptidoglycan biosynthesis
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NMB0811 (murB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMB0811 (murB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
    NMB0811 (murB)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.98  UDP-N-acetylmuramate dehydrogenase
     NMB0811 (murB)
Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   NMB0811 (murB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MurB_C FAD_binding_4
Motif
Other DBs
NCBI-GeneID: 902926
NCBI-ProteinID: NP_273853
UniProt: Q9K016
Position
complement(836154..837194)
Genome map
AA seq 346 aa AA seqDB search
MQPIRYRTDLTPYNTFGLRAQARAFIALEHADELRDIVRLLEFDRDTVLWLGGGSNILLM
QDYAGLVVHMENKGIREIARSDGMVLIEAQAGEIWHDFVLHTVALGLSGLENLSLIPGTV
GASPVQNIGAYGVEAKDVIHSVRCFDLDTETFVELANADCRFAYRESLFKQEGKGRYVIV
SVVFALKTHFVPTLGYGDLAAAVAELSAGRVPTAKDVSDAVCAIRNSKLPNPNVLGNVGS
FFKNPVVSAEKAATLLQRHPDMPRYPQPDGSVKLAAGWLIDQCRLKGFQIGGAAVHDRQA
LVLVNKNNASANDVRQLAQHIKFTVFARFQVELHAEPNWLPASFSL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcaacccatccgataccgaaccgaccttaccccctacaacaccttcggtcttcgcgcc
caagcccgggcctttatcgcgctcgaacatgccgacgagttgcgcgacatcgtccgactg
ctggagttcgaccgcgatactgttttatggctgggcggcggcagcaacatccttttgatg
caggattacgccggactggtcgtacacatggaaaacaaaggcatacgcgagattgcgcgt
tcagacggcatggttctgattgaagcgcaggcgggcgaaatttggcacgattttgtcctg
cacaccgttgcgctgggtttgagcggtttggaaaacctgagcctgattccgggtacggtc
ggcgcatcgcccgtgcagaacatcggcgcatacggcgtggaggcgaaagacgtgattcac
agcgtgcgctgctttgatttggatacggagacctttgtcgagcttgccaatgccgactgc
cgcttcgcctaccgcgaaagcctgttcaagcaggagggtaaagggcgttatgtgattgtt
tcggtcgtatttgcattaaaaacgcattttgtgccgactttgggttacggcgatttggcg
gccgccgttgccgaactgagcgcgggcagggtcccgacggcgaaagatgtttccgatgca
gtgtgtgcaatccgcaacagtaaacttcctaatcctaacgtgcttggcaatgtcggcagt
ttctttaaaaaccccgtcgtcagcgcagaaaaagccgccaccttgttgcagcggcatcct
gatatgccgcgctatccgcagcccgacggttcggtcaaactcgccgccggctggctgatc
gaccaatgccgtctgaaaggcttccaaatcggcggcgcggcggtacatgacaggcaggct
ttggtcttagtgaacaaaaacaacgcctcggcaaacgatgtccggcagttggcgcaacac
atcaaatttacagtatttgctcggtttcaggtagaattgcacgccgaacctaattggctg
cctgcttcgttcagcctgtaa

DBGET integrated database retrieval system