KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0815Help
Entry
NMB0815           CDS       T00027                                 

Gene name
purA
Definition
(RefSeq) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00230  Purine metabolism
nme00250  Alanine, aspartate and glutamate metabolism
nme01100  Metabolic pathways
Module
nme_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NMB0815 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB0815 (purA)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     NMB0815 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-GeneID: 902930
NCBI-ProteinID: NP_273857
UniProt: Q9K012
Position
840201..841505
Genome map
AA seq 434 aa AA seqDB search
MAMAKNVVVIGAQWGDEGKGKIVDWLAEEAGGVVRFQGGHNAGHTLVVGGKKTILRLIPS
GILHESLDCFIGSGVVVSPEALLGEIDELNAAGVKNVEGRLKIAPTCPLILPYHIALDQA
REASRGKGKIGTTGRGIGPAYEDKVARRAIRAADLLHPEKLREKLDAVLAYYNVQLQHLH
NAEPVKAEDVMAVIEKVAPRIAPMITDVSRVLNEKNKNGEKLLFEGAQGALLDIDYGTYP
FVTSSNCLAGAASAGAGVGPQMLDYVLGIVKAYTTRVGSGPFPTELFDEVGVGLAERGHE
FGSVTGRARRCGWFDAAALKRSIQINGISGMCITKLDVMDGVETINICVGYELPDGGKTD
ILPCGSDAVETCKPIYETMPGWRESTFGVKDYGALPENAKAYLKRIEEVCGAPVAIVSTG
PDREETIVLHHPFA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggctatggctaaaaatgttgtagtaatcggcgcacagtggggcgacgagggtaaaggt
aaaatcgttgactggctggcggaagaagccggcggcgtggtgcgcttccaaggcggccac
aatgcgggccataccttggttgtcggcggcaaaaaaaccattttgcgcctgattccgagc
ggcatcctgcatgaaagtttggactgcttcatcggttcgggcgttgtcgtctcccccgaa
gccctgttgggcgaaatcgacgagttgaacgcggcaggcgtgaaaaacgtcgaaggccgt
ctgaaaatcgcgccgacctgcccgctgatcctgccttaccacatcgcgctcgaccaagcc
cgcgaagcatcgcgcggcaaaggcaaaatcggcacgaccggccgcggcatcggccctgcc
tacgaagacaaagtggcacgccgcgccattcgcgccgccgatttgctgcatcctgaaaaa
ctgcgtgaaaaactggatgccgtccttgcctattacaatgtccaactgcaacatctgcac
aatgccgagccggttaaagcggaagacgtgatggcggttatcgaaaaagtcgcgccgcgc
attgcgccgatgattaccgacgtgtcccgcgtgttgaacgagaaaaacaaaaacggcgaa
aaactgctgtttgaaggcgcgcaaggtgcgttgttggacatcgactacggcacttatccc
ttcgttacctcgtccaactgtctggcgggcgcagcttcggcaggcgcgggcgtaggtcct
caaatgctggattatgttttgggcatcgtcaaagcctataccacgcgcgtcggttcgggc
ccgttcccgaccgaattgttcgacgaagtaggcgtaggtttggcagaacgcggacacgaa
ttcggttcggtaaccggacgcgcacgccgctgcggctggtttgatgccgccgccctgaaa
cgctccatccaaatcaacggcatttccggtatgtgtattactaaactcgatgtaatggac
ggcgttgaaaccatcaatatctgcgtcggctatgaattgcccgacggcggcaaaaccgac
atcctgccttgcggttccgatgcggtggaaacctgcaagccgatttacgaaaccatgccc
ggctggcgcgaatccactttcggcgtgaaggactacggcgcattgcccgaaaacgccaaa
gcatatttgaaacggattgaagaagtctgcggcgcgccggtcgccatcgtctccaccggc
cccgaccgagaagaaacgattgtgctgcatcatccgttcgcataa

DBGET integrated database retrieval system