KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0823Help
Entry
NMB0823           CDS       T00027                                 

Gene name
adk
Definition
(RefSeq) adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00230  Purine metabolism
nme00730  Thiamine metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
Module
nme_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NMB0823 (adk)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    NMB0823 (adk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nme04147]
    NMB0823 (adk)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     NMB0823 (adk)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NMB0823 (adk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADK AAA_17 ADK_lid Hydin_ADK AAA_18
Motif
Other DBs
NCBI-GeneID: 902938
NCBI-ProteinID: NP_273865
UniProt: P0A0U7
Position
845916..846563
Genome map
AA seq 215 aa AA seqDB search
MKALLLGAPGAGKGTQAQFITAAFGIPQISTGDMLRAAIKAGTPLGLEAKKIIDEGGLVR
DDIIIGMVKERIAQDDCKNGFLFDGFPRTLAQAEAMVEAGVDLDAVVEIDVPDSVIVDRM
SGRRVHLASGRTYHVTYNPPKVEGKDDVTGEDLIQRDDDKEETVKKRLAVYHEQTEVLVD
FYSKLEGEHAPKYIKVDGTQAVEAVKAEVLGALGK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacttttaggcgcgccgggcgcgggcaaaggcactcaggcgcaattcatc
accgcagcgttcggcattccgcaaatctctaccggcgacatgctccgtgccgcgattaag
gcaggcacgcccttgggtttggaagcgaaaaaaatcattgacgaaggcggcttggtgcgc
gacgacatcattatcggcatggtcaaagaacgcatcgcgcaagacgactgcaaaaacggt
ttcttgtttgacggtttcccgcgcacattggcacaagccgaagcgatggttgaagcaggc
gtggatttggatgcagtcgttgaaatcgatgtgcctgacagcgtgattgtcgaccgcatg
agcggccgccgcgtgcatttggcttccggccgtacttaccacgttacctacaacccgccc
aaagttgaaggcaaagacgacgtaaccggcgaagatttgattcagcgcgacgacgacaaa
gaagaaaccgtgaaaaaacgccttgccgtttaccacgagcaaaccgaagttttggtcgat
ttttacagcaaactggaaggcgaacacgcgcctaaatacatcaaagttgacggcacccaa
gcagtagaagccgtgaaagccgaagtattgggcgcattgggcaaataa

DBGET integrated database retrieval system