KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0824Help
Entry
NMB0824           CDS       T00027                                 

Gene name
pyrF
Definition
(RefSeq) orotidine 5'-phosphate decarboxylase
  KO
K01591  orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00240  Pyrimidine metabolism
nme01100  Metabolic pathways
Module
nme_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    NMB0824 (pyrF)
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     NMB0824 (pyrF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase
Motif
Other DBs
NCBI-GeneID: 902939
NCBI-ProteinID: NP_273866
UniProt: Q9K005
Position
847089..847829
Genome map
AA seq 246 aa AA seqDB search
MNPLISDFQTPQQRTPVIVALDFSNEKDTLGFVRNLDPTLCQIKIGKELFTATGRNLAES
LINQGFKLFLDLKYHDIPHTVAQACKVAADMGVWMVDMHASGGRRMMEAAAEAVAGYGTK
PLLIGVTVLTSMEQSDLAEIGLNTAPEEQVIRLAKLAQSSGLDGVVCSAQEAAPLRRELG
QDFVLVTPGIRLDVAGNNDDQRRIMTPAEALAAGSTYLVMGRPVTQAADPVAVLREVNRV
ANLEAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctttaatctccgacttccaaactccgcaacaacgcacccccgttatcgtcgcc
cttgatttttccaacgaaaaagacacgctcggattcgtccgcaaccttgacccgacattg
tgtcaaatcaaaatcggcaaagagctgtttaccgcgacgggacgcaatttggcagaaagc
ttaatcaatcaaggtttcaaacttttcctcgatttgaaataccacgatattccccacacc
gtcgcgcaagcctgcaaagtcgctgccgatatgggcgtttggatggtcgatatgcacgca
tcgggcggccgccgtatgatggaagccgcagcagaagccgttgccggatacggcacgaag
ccgctcttaatcggcgtaaccgtgttgaccagcatggaacaaagtgatttggcggaaatc
ggtttgaacaccgcccctgaagaacaagtcatccgcttggcaaaactggcgcaaagttcg
ggcttggacggcgtggtctgttccgcccaagaagccgcgccgctgcgccgcgaattggga
caggattttgtcttggtcacgcccggcatccgcttggacgttgccggcaataatgatgac
cagcgccgcatcatgacaccggccgaagccttggctgccggttcgacttatttggtaatg
ggtcgtcctgtaacccaagctgccgatccggtagccgtattgcgcgaagtgaaccgcgtg
gcaaaccttgaagcaaactga

DBGET integrated database retrieval system