KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0828Help
Entry
NMB0828           CDS       T00027                                 

Gene name
rfaD
Definition
(RefSeq) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00540  Lipopolysaccharide biosynthesis
nme01100  Metabolic pathways
Module
nme_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB0828 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:nme01005]
    NMB0828 (rfaD)
Enzymes [BR:nme01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     NMB0828 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Unusual sugar
  NMB0828 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 DapB_N adh_short NAD_binding_10 TruD Ldh_1_N KR
Motif
Other DBs
NCBI-GeneID: 902942
NCBI-ProteinID: NP_273870
UniProt: Q9K002
Position
851289..852293
Genome map
AA seq 334 aa AA seqDB search
MTIIVTGAAGFIGSNIVKALNQRGITDIVAVDNLSKGEKFKNLAECEIAHYLDKHEFIRQ
VREHILPYQNIEAVFHQGACSDTMNHDGLYMMDNNYQYTLDLLDWCQDERIPFLYASSAA
VYGKGEIFREERELEKPLNVYGYSKFLFDQVLRRRMKEGLTAQVVGFRYFNVYGQHEQHK
GRMASVAFHHFHQYREHGYVNLFGSNDGYGNGEQTRDFVSVEDVAKVNLYFFDHPELSGI
YNLGTGRSQQFNELAAATVNACRAAEGKPEMSLKELVEEELIRYIPFPDALKGKYQSFTQ
ADITKLREAGYKEEFFDVKSGVDRYVKWMLENLA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcatcgtaacaggcgcggccggctttatcggcagcaacatcgtcaaagcactt
aatcaacgcggtattactgacattgttgccgtcgataatttgagcaaaggcgaaaaattc
aaaaaccttgccgagtgcgaaatcgcccattatctcgacaaacacgaattcatccgccaa
gtgagggaacacattttaccttatcaaaacatcgaagccgttttccatcaaggcgcgtgt
tccgatacgatgaaccacgacggtttgtatatgatggacaacaactaccagtacacgctg
gatttgctggactggtgtcaggacgaacgcatccccttcctttatgcctccagtgcggcg
gtttacggcaaaggagaaatcttccgcgaagagcgcgaactcgaaaaaccgctcaacgtg
tacggctactccaaattcctgttcgaccaagtattgcgtcgccgcatgaaagaaggtctc
accgcccaagtcgtcggcttccgctacttcaatgtttacggacaacacgaacaacacaaa
ggccgcatggcatccgtcgccttccaccacttccaccaataccgcgaacacggttacgtc
aacctgttcggcagtaacgacggctacggcaacggcgaacaaacccgcgacttcgtcagc
gtcgaagacgttgccaaagtcaacctctacttcttcgaccatcccgaactttccggcatc
tacaacctcggtaccggccgcagccaacagttcaacgaactcgccgccgccaccgtcaac
gcatgccgcgccgccgaaggcaaacctgaaatgagcttgaaagagttggtagaagaagaa
cttatccgctacattcccttccccgacgcgctcaaaggcaaataccaaagcttcacccaa
gccgacatcaccaaattgcgcgaagccggatataaggaagaatttttcgatgtcaaatca
ggcgtcgaccgctacgtcaaatggatgctggaaaatttggcttaa

DBGET integrated database retrieval system