KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0849Help
Entry
NMB0849           CDS       T00027                                 

Gene name
dcd
Definition
(RefSeq) deoxycytidine triphosphate deaminase
  KO
K01494  dCTP deaminase [EC:3.5.4.13]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00240  Pyrimidine metabolism
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    NMB0849 (dcd)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.13  dCTP deaminase
     NMB0849 (dcd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dUTPase Flagellar_put
Motif
Other DBs
NCBI-GeneID: 902963
NCBI-ProteinID: NP_273890
UniProt: P63904
Position
complement(875175..875741)
Genome map
AA seq 188 aa AA seqDB search
MSIKSDKWIRRMSEEFGMIDPFEPNQIKEADGKRIISYGTSSYGYDIRCANEFKIFTNIN
STIVDPKNFDPKNFVTVEDDCCIIPPNSFALARTVEYFRIPRNVLTVCLGKSTYARCGII
VNVTPFEPEWEGYVTLEFSNTTPLPAKIYAGEGVAQVLFFESDEICETSYKDRNGKYMGQ
TGVTLPKA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcaagtccgacaaatggatacgccgaatgagcgaagaattcggcatgatcgac
cctttcgagccgaaccaaatcaaagaagccgacggcaaacgcatcatctcctacggtacg
tccagctacggctacgacatccgctgcgcaaacgaatttaaaatcttcaccaacatcaac
agcaccatcgtcgatcccaaaaacttcgacccgaaaaacttcgttaccgttgaagacgac
tgctgcatcatcccgcccaattccttcgcactggcgcgcacggtcgaatatttccgcatc
ccgcgcaacgtcctgaccgtctgcttgggcaaatccacctacgcccgctgcggcattatc
gtcaacgttaccccgttcgaaccggaatgggaaggctacgttaccctcgaattttccaac
accacccccctgcccgccaaaatctacgcaggcgaaggcgtggcgcaagtcctcttcttc
gagagcgacgaaatctgcgaaacctcatacaaagaccgcaacggcaaatatatggggcaa
accggcgttaccctgcccaaagcctga

DBGET integrated database retrieval system