KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0869Help
Entry
NMB0869           CDS       T00027                                 

Definition
(RefSeq) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00270  Cysteine and methionine metabolism
nme00330  Arginine and proline metabolism
nme00410  beta-Alanine metabolism
nme00480  Glutathione metabolism
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB0869
   00330 Arginine and proline metabolism
    NMB0869
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NMB0869
   00480 Glutathione metabolism
    NMB0869
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     NMB0869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Methyltransf_25 Methyltransf_11 Methyltransf_12 MTS Methyltransf_18 Methyltransf_2
Motif
Other DBs
NCBI-GeneID: 902983
NCBI-ProteinID: NP_273910
UniProt: P60594
Position
complement(888256..889047)
Genome map
AA seq 263 aa AA seqDB search
MARHPYRRLRPAKSGFPEVGISEEGNIRSLHLGSDTVQSSMNLDHPSELVLSYSRAMMGW
LLFTDALPQHITQIGLGGGSFARWIDTYLPDTRQTAVDINPQVIAIARNLFELPFEGEKF
EIIEADGAEYIKVFRHNTDVILVDGFDGEQIIDALVEEPFFRDCRNALSSDGIFVTNWWS
GDKRYQRFIERLLSVFEGRVLELPAESHGNVAVMAFQSSPKEQNIDKLKKRADKLSNAYG
LDFHRMLAGLKASNPNNGKHFHL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcaagacatccctaccgccgcctgcgtcctgcaaaatccggctttcccgaagtcggc
atttccgaagaaggcaatatccgttcgcttcacttgggcagcgacaccgttcaaagctcg
atgaacctcgaccacccgtccgagctggtgctctcttacagccgcgcgatgatgggctgg
ctgctgtttaccgacgctcttccgcaacatatcacccaaatcggcttgggcggcggctcg
tttgcacgctggatagatacctacctgcccgacacgcgccaaaccgccgtggacatcaat
ccgcaggtcatcgccattgcccgcaacctgttcgagttgcctttcgagggcgagaaattt
gaaattattgaagcagacggtgcagaatatatcaaagtcttccgccacaacaccgatgtg
attttggtggacgggttcgacggcgaacaaatcatcgatgcgctggttgaagaaccgttc
ttccgagactgccgcaacgcactctcttcagacggcatattcgtaaccaactggtggagc
ggcgacaaacgctaccaacgcttcatcgaacggttgttgagcgtttttgaagggcgcgtc
ttggaacttcctgccgaaagccacggcaatgtcgcggtaatggccttccaaagcagcccc
aaagagcaaaacatagacaaactcaaaaaacgtgccgacaaactgagcaacgcatacgga
ttggacttccaccgtatgcttgccggcctgaaagcgtccaaccccaacaacggcaagcat
ttccacctttaa

DBGET integrated database retrieval system