KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0874Help
Entry
NMB0874           CDS       T00027                                 

Gene name
ipk
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00900  Terpenoid backbone biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMB0874 (ipk)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     NMB0874 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-GeneID: 902990
NCBI-ProteinID: NP_273915
UniProt: Q9JZW4
Position
894029..894874
Genome map
AA seq 281 aa AA seqDB search
MNIADGRQAFSAPAKLNLDLRITGRREDGYHNIESIFCLIDLQDTVYLKPRDDGKIILHN
PVDGMPQEVDLSYRAASLLQKYARNPAGVEIWLDKKIPTGAGLGGGSSDAATVLLVLNRW
WQCGLTQRQLIDSGAALGADVPFFIFGKNAFARGIGDRLDEMDIPKQWYVIVKPPVHVST
AKIFTHESLTRNSASSIMPTFQNLQPFRNDMQAVVFKEYPEVWKAYSELSRYGFALMTGS
GACVFTACQDRNSAYNIYRQVSDLYEAYLAEGLSKHPLLSV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgcggacggacggcaggcgttttccgcacctgcaaaactgaatctcgatttg
aggattaccggcaggcgggaagacggttatcacaatatcgaaagcatattctgcctgata
gatttgcaggataccgtatatttgaaaccgagggacgacggcaaaatcatcctgcacaat
ccggttgatggcatgccgcaggaagtagatttgagctaccgtgccgcatcgttgctgcaa
aaatatgcgcgcaaccccgccggcgtggaaatatggctggacaaaaaaatcccgacaggg
gcgggtttgggcggcggaagctcggatgcggcaaccgttttgctggtgttgaaccgttgg
tggcagtgcggtctgacgcagcggcagctcattgattcgggcgcggctctgggggcggac
gtaccgttttttattttcggcaaaaatgcgtttgcgcggggtataggcgacaggctggac
gaaatggatattccgaaacagtggtatgtcatcgtcaaaccgcccgtccacgtttccact
gcaaaaattttcacacacgaaagcttgacacgaaattccgcctcaagcataatgccgact
ttccaaaatctgcaaccgtttagaaatgatatgcaggcagttgtatttaaagaataccct
gaagtttggaaagcctattccgagttgtcccgatatggatttgccttaatgacaggttcc
ggtgcgtgtgtattcacggcgtgtcaagataggaatagcgcatacaatatataccgacaa
gtttcagatttgtacgaggcatatttggcagagggtctttcaaaacatcctttgttgtcc
gtataa

DBGET integrated database retrieval system