KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0875Help
Entry
NMB0875           CDS       T00027                                 

Gene name
prsA
Definition
(RefSeq) ribose-phosphate pyrophosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00030  Pentose phosphate pathway
nme00230  Purine metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMB0875 (prsA)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NMB0875 (prsA)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     NMB0875 (prsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Motif
Other DBs
NCBI-GeneID: 902994
NCBI-ProteinID: NP_273916
UniProt: P65235
Position
895296..896279
Genome map
AA seq 327 aa AA seqDB search
MAAYDSLMVFTGNANPELAQRVVRHLDISLGNASVSKFSDGEVAVELLENVRGRDVFILQ
PTCAPTNDNLMEILTMADALKRASAGRITTAIPYFGYARQDRRPRSVRVPISAKLVANML
YSAGIDRVLTVDLHADQIQGFFDIPVDNIYATPILLNDIKQQRIENLTVVSPDIGGVVRA
RAVAKSLNADLAIIDKRRPKANVAEVMNIIGDIQGRTCLIVDDMIDTANTLCKAAVALKE
RGAERVLAYASHAVFSGEAVSRIASSEIDQVVVTDTIPLSEAAKNCDRIRQVTIAGLLAE
TVRRISNEESVSYLFNEEVMTGSMLLP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgtacgacagtttgatggtatttacaggcaatgccaatcccgaattggcacaa
cgtgttgtcaggcatttggacatttctttgggcaatgcttccgtatccaagttttcagac
ggcgaagttgccgtcgaactgttggaaaacgtacgcgggcgcgatgttttcatccttcag
ccgacctgtgcgccgaccaatgacaacctgatggaaatcctgacgatggcggatgcactg
aagcgtgcttcggcaggtcgtattaccacagccattccgtatttcggctatgcgcgccaa
gaccgccgtccgcgttccgtccgcgttccgatttctgccaaactggtggcaaatatgctg
tattcggcagggatcgaccgtgttttgactgtcgatttgcatgccgaccagattcaaggt
ttcttcgatattccggtggacaatatttatgccaccccgattctgttgaacgacatcaaa
caacagcggattgaaaatctgaccgtcgtcagcccggacatcggcggtgtcgtccgcgcc
cgcgccgtggcaaaatccctgaatgccgacttggcaatcatcgacaaacgccgcccgaaa
gccaatgtggcggaagtcatgaacatcatcggcgatattcaaggtagaacctgtctgatt
gtggacgatatgattgacactgcaaatacgctgtgcaaagccgccgtcgccctgaaagag
cggggggctgaacgtgttctagcctatgccagccacgccgtattctccggagaggcggtc
agccgtatcgcctcatccgaaatcgaccaggtggtcgtaaccgataccattcctttgtct
gaagcggctaaaaactgcgaccgtatccgtcaggtaacgattgccggtctgttggccgaa
accgtccgccgcattagcaatgaagaatccgtctcatatcttttcaatgaagaagtgatg
acaggcagcatgttgctgccataa

DBGET integrated database retrieval system