KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0879Help
Entry
NMB0879           CDS       T00027                                 

Gene name
cysA
Definition
(RefSeq) sulfate ABC transporter ATP-binding protein
  KO
K02045  sulfate transport system ATP-binding protein [EC:3.6.3.25]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00920  Sulfur metabolism
nme02010  ABC transporters
Module
nme_M00185  Sulfate transport system
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NMB0879 (cysA)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    NMB0879 (cysA)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.25  sulfate-transporting ATPase
     NMB0879 (cysA)
Transporters [BR:nme02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfate transporter [MD:M00185] [OT]
    NMB0879 (cysA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA AAA_23 AAA_16 AAA_22 ABC_ATPase RsgA_GTPase AAA_30 NACHT SbcCD_C AAA_25 AAA_14 AAA_18 DLIC Rad17 AAA_29 AAA_28 AAA_15 AAA_5 RecA PduV-EutP
Motif
Other DBs
NCBI-GeneID: 902998
NCBI-ProteinID: NP_273920
UniProt: Q9JZW0
Position
complement(899943..901016)
Genome map
AA seq 357 aa AA seqDB search
MSITIQNLNKHFGNFHALKNINLNVPTGKLVSLLGPSGCGKTTLLRIIAGLENADGGNIL
FDGQDVTAKHVRERKVGFVFQHYALFRHMNVFDNVAFGLTVLPKSERPSKGQIRAKVEEL
LKLVQLSHLAKSYPHQLSGGQRQRIALARALAVEPKLLLLDEPFGALDAKVRKELRTWLR
DIHHNLGVTSILVTHDQEEALEVSDEIVVMNHGKIEQTGSAEAIYRKPENAFVTEFLGET
DAFEGRIEKGFWHYNGFAWKLDAQYKWQEQTATGYIRPHEWQIAAEHETPMICAEIEKIH
AVGALTHILVKHDKQDVHITLAGSDAARYPIAEGKELKLIPKQVYVFSQNELIEYSI
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcaccatccaaaacttaaacaaacacttcggcaattttcacgcgctgaaaaac
atcaacctcaacgtccccaccggcaaactcgtttccctgctcggcccgtccggctgcggc
aaaaccacacttttacgcattatcgccggactggaaaacgccgacggcggcaatatcctg
tttgacgggcaagacgtaaccgccaaacatgtgcgcgagcgcaaagtcggcttcgtgttc
caacactacgcccttttccgccatatgaacgtgtttgacaacgtcgctttcggtttgacc
gtattgcccaagtccgaacgcccgtccaaaggacaaatccgcgccaaagtcgaagaatta
ctcaagctcgtgcagctctctcatttggcaaaatcctatccgcaccaactctccggcggg
caacgccagcgcatcgccctcgcccgcgcgcttgcggtcgaacccaaactcttgcttttg
gacgaacccttcggcgcgttggatgccaaagtacgcaaagaattacgcacctggctgcgc
gacatccatcacaacctgggtgtaaccagcattctggttacgcacgaccaagaagaagcc
ctcgaagtttccgacgaaatcgtcgtgatgaaccacggcaaaatcgaacaaaccggcagc
gccgaagctatttaccgcaaacccgaaaatgccttcgttaccgagttcctcggcgaaacc
gacgcttttgaaggacgcatcgaaaaaggcttctggcattacaacggcttcgcgtggaaa
ttggacgcgcaatacaaatggcaggaacaaaccgccaccggctatatccgcccgcacgaa
tggcagatcgccgccgaacacgaaacaccgatgatttgtgccgaaatcgaaaaaatccac
gccgtcggcgcattgacgcatattctggtaaaacacgacaaacaggacgtacatatcacg
ctggcaggcagcgatgccgcgcgttacccaatcgccgaaggcaaagaattgaagctgatt
ccgaaacaggtttatgtcttctctcaaaacgaactgattgaatattcgatttaa

DBGET integrated database retrieval system