KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0920Help
Entry
NMB0920           CDS       T00027                                 

Gene name
icd
Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00020  Citrate cycle (TCA cycle)
nme00480  Glutathione metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
nme01210  2-Oxocarboxylic acid metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nme_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMB0920 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NMB0920 (icd)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     NMB0920 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH DUF4115 FMN_red
Motif
Other DBs
NCBI-GeneID: 903041
NCBI-ProteinID: NP_273960
UniProt: Q9JZS1
Position
complement(932130..934355)
Genome map
AA seq 741 aa AA seqDB search
MTQKSTIVYTHTDEAPALATQSLLPIVQAFARHADIDVKTSDISLSGRILAAFPEYLTEA
QRVPDALAELGELVKQPDANVIKLPNISASVPQLTAAIKELQSKGFAVPDYPADPQTDEE
KAVRERYDRIKGSAVNPVLREGNSDRRAPKAVKNFAKKNPHSMGAWTKDSKTHVATMQSG
DFFHNEQSVIVPEATSVSIVFTDKQGNKKELREPVALKAGEIIDATVMSKKALLAFLAEQ
VKDAKAKGVLFSLHMKATMMKVSDPIIFGHAVKVFFAPVFEKFGDKLAAAGVNVNNGFGN
LLANLDKLDADTRTAVEAEIAAVYAANPDLAMVDSDKGITNLHVPSDVIVDASMPAMIRN
SGRMWDKNGKAQDTKAVIPDSSYAGVYQATIDFCREHGAFDPTTMGTVPNVGLMAQAAEE
YGSHNKTFEIEADGQVQVIDAAGKVLMQHDVEAGDIWRMCQTKDAPVKDWVQLAVNRARL
SNTPAVFWLDENRPHDKSLLAKVKAYLAELDTNGLDIRVLAPEEAAKFSLGRLKNGEDTI
SVTGNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGMFETGAGGSAPKHVQQFLEENHL
RWDSLGEFLALAVSFEHLAQKTGNAKAQVLADTLDAATEKLLLNDKSPKRKAGELDNRGS
HFYLTLYWAQELAAQDKDAELKAAFTPLAAALTADEAKIVAELSAVQGKAADIGGYYAAN
PEKAAQVMRPSVTFNQALNAL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaaaatccaccattgtttatacccataccgacgaagcacccgcgctggcgacc
caatcgctgctgccgattgtgcaggcttttgcccgccacgccgatattgatgtcaaaacc
agcgacatttctctctccggccgtattttggcggcgtttcccgaatacctgaccgaagcg
caacgcgtacctgatgcgcttgccgaattgggcgaactggtgaaacaacccgatgcaaac
gtaatcaaactgccgaacatcagcgcgtccgtaccgcaactgactgccgcgattaaagaa
ttgcaatctaaaggctttgccgttcccgactatcccgccgacccgcaaaccgatgaagaa
aaagccgtacgcgaacgctacgaccgcatcaaaggcagcgcggtaaaccctgtcctgcgt
gaaggcaactccgaccgtcgcgcccctaaagcagtgaaaaactttgcgaaaaaaaatccg
cacagcatgggcgcatggaccaaagactccaaaacccacgttgccaccatgcaaagcggc
gacttttttcataacgaacaatctgttatcgtacctgaagcgacttccgtatccatcgta
ttcaccgacaaacaaggcaacaaaaaagagctgcgcgagcccgtcgccctgaaagccggc
gaaatcatcgacgcgaccgtgatgagtaaaaaagccctgctcgccttccttgccgaacaa
gtaaaagatgcgaaagcaaaaggcgtgttgttctcgctgcacatgaaagccactatgatg
aaagtgtccgacccgattatcttcggacacgccgtcaaagtattcttcgcgcctgttttt
gaaaaattcggcgacaaactggctgctgccggcgtcaacgttaacaacggcttcggcaac
ctgcttgccaatctggacaaactggatgcggacacccgcaccgccgtcgaagccgaaatc
gccgccgtttacgctgccaaccccgatttggcgatggttgattccgacaaaggcatcacc
aacctgcacgttcccagcgatgtcatcgtcgatgcctctatgcctgcgatgattcgcaat
tccggccgtatgtgggacaaaaacggcaaagcgcaagacaccaaagccgtgattcccgac
agcagctatgccggcgtttaccaagcaaccatcgacttctgccgcgaacacggcgcattt
gacccgacaaccatgggtactgtgcccaacgtcggactgatggcgcaagcggcggaagaa
tacggctcgcacaacaaaacctttgaaatcgaagccgacggccaagtccaagtcattgat
gcggcaggaaaagtcctaatgcagcacgacgttgaagccggcgacatctggcgtatgtgc
caaaccaaagacgctccggttaaagactgggtacaacttgccgtcaaccgcgcccgtctg
agcaacacgcctgccgtgttctggctcgacgaaaaccgtccgcacgacaagagcctgctc
gccaaggttaaagcctaccttgccgaactggataccaatggcctcgacatccgcgtcctc
gctcctgaagaagccgccaagttcagcttgggtcgtctgaaaaacggcgaagacaccatc
tccgtaaccggtaatgtcttgcgcgactacctgaccgacttgttcccaattttggaactc
ggcacaagcgcgaaaatgctgtctatcgttccattgatgaacggcggcggtatgtttgaa
accggcgcgggcggttctgcaccgaaacatgttcaacaattcctcgaagaaaaccatttg
cgctgggactcgctgggcgaattcctcgcactcgccgtatcgtttgaacatttggcgcaa
aaaaccggcaatgccaaagcccaagtcctcgccgacactttggatgcagccaccgaaaaa
ctgctgttgaacgacaaatcgcctaaacgtaaagccggcgaactcgacaaccgcggcagc
catttctacctcaccctctactgggcgcaagaattggcggcgcaagacaaagatgccgaa
ctgaaagccgcatttacgccattggcagccgctttgaccgccgacgaagcgaaaatcgtt
gccgagctttccgccgtacaaggcaaagcggccgacatcggcggctactacgccgccaat
cctgaaaaagccgcacaagtgatgcgtccgagcgtaacctttaatcaggcactaaacgcc
ttataa

DBGET integrated database retrieval system