KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0929Help
Entry
NMB0929           CDS       T00027                                 

Gene name
dapA
Definition
(RefSeq) 4-hydroxy-tetrahydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00261  Monobactam biosynthesis
nme00300  Lysine biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Module
nme_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    NMB0929 (dapA)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    NMB0929 (dapA)
Enzymes [BR:nme01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     NMB0929 (dapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-GeneID: 903050
NCBI-ProteinID: NP_273968
UniProt: Q9JZR4
Structure
PDB: 

Position
complement(944072..944947)
Genome map
AA seq 291 aa AA seqDB search
MLQGSLVALITPMNQDGSIHYEQLRDLIDWHIENGTDGIVAVGTTGESATLSVEEHTAVI
EAVVKHVAKRVPVIAGTGANNTVEAIALSQAAEKAGADYTLSVVPYYNKPSQEGIYQHFK
TIAEATSIPMIIYNVPGRTVVSMTNDTILRLAEIPNIVGVKEASGNIGSNIELINRAPEG
FVVLSGDDHTALPFMLCGGHGVITVAANAAPKLFADMCRAALQGDIALARELNDRLIPIY
DTMFCEPSPAAPKWAVSALGRCEPHVRLPLVPLTENGQAKVRAALKASGQL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaggtagcttggttgccctgattaccccgatgaatcaagacggcagcatccat
tacgaacaactccgcgacttaatcgactggcacattgaaaacggcacggacggcatcgtt
gccgtcggcacgacaggcgaatccgccaccctctccgtcgaagaacacaccgccgtcatc
gaagccgtcgtcaaacacgttgccaaacgcgtccccgtcatcgccggcacaggggcaaac
aacaccgtcgaagccatcgccctttcccaagccgccgaaaaagccggggcggactacacc
ctctccgtcgtcccctattacaacaagccctcccaagaaggcatttaccaacatttcaaa
accatcgccgaagccacttcgattccgatgattatctacaacgtgcccggccgtaccgtc
gtcagcatgactaacgacactatcctgcgccttgccgaaatccccaacatcgtcggcgtg
aaagaagccagcggcaacatcggcagcaacatcgaactcatcaaccgcgcgcccgaaggc
ttcgtcgtcctttccggcgacgaccacaccgccctgccgttcatgctctgcggcggacac
ggcgtgattaccgtagccgccaacgccgcgcccaagctctttgccgatatgtgccgcgcc
gcgcttcaaggcgatatcgcccttgcacgcgaactcaacgaccgactgattccgatttac
gacaccatgttctgcgaacccagccccgccgcaccgaaatgggcggtatccgccctgggc
agatgcgaaccgcacgtccgcctgccgctcgttccgctgacggaaaacggacaagcaaaa
gtccgcgccgccctgaaagcctcaggacaactttaa

DBGET integrated database retrieval system