KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0940Help
Entry
NMB0940           CDS       T00027                                 

Gene name
metX
Definition
(RefSeq) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00270  Cysteine and methionine metabolism
nme00920  Sulfur metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    NMB0940 (metX)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB0940 (metX)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     NMB0940 (metX)
    2.3.1.46  homoserine O-succinyltransferase
     NMB0940 (metX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Esterase Ser_hydrolase
Motif
Other DBs
NCBI-GeneID: 903060
NCBI-ProteinID: NP_273978
UniProt: Q9JZQ5
Position
complement(953968..955107)
Genome map
AA seq 379 aa AA seqDB search
MSQNASVGIVMPQKIPFEMPLVLENGKTLPRFDLMIETYGELNAEKNNAVLICHALSGNH
HVAGRHSAEDKYTGWWDNMVGPGKPIDTERFFVVGLNNLGGCDGSSGPLSINPETGREYG
ADFPVVTVKDWVKSQAALADYLGIEQWAAIVGGSLGGMQALQWTISYPERVRHALVIASA
PKLSTQNIAFNDVARQAILTDPDFNEGHYRSHNTVPARGLRIARMMGHITYLAEDGLGKK
FGRDLRSNGYQYGFGVEFEVESYLRYQGDKFVGRFDANTYLLMTKALDYFDPAADFGDSL
TRALQNVKAKFFVASFSTDWRFAPERSHELVKALIAAQKSVQYIEVKSAHGHDAFLMEDE
AYMRAVAAYMNNVYKECQQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaatgcctcggtgggcattgtaatgccccaaaaaattccgtttgagatgccg
ctggttttggaaaacggtaaaactttgccgcgtttcgatctgatgattgaaacctacggc
gagctgaatgctgaaaaaaacaatgcggttttaatctgccacgcgctgtcgggcaaccat
catgttgcgggcaggcattcggcggaagataaatatacgggctggtgggacaatatggtc
ggacctggcaaaccgattgatacggaacgttttttcgtggtcggtttgaataatctgggc
ggctgcgacggcagcagcgggcctttgtcgattaatcctgaaacgggcagggaatacggc
gcggattttccggtggttacggtgaaggactgggtaaaatcccaagccgcgcttgccgac
tatctcggtatcgaacaatgggcggcgattgtcggtggcagcttgggcggtatgcaggcc
ttgcagtggacgatttcctatcccgagcgcgtgcgccatgctttagtgattgcgtctgcg
ccgaaactgtccacgcaaaatatcgcgtttaacgatgtggcgcgtcaggcaattttgacc
gaccctgatttcaatgaaggacattaccgcagccacaataccgttcctgcacggggcttg
cggattgcccgcatgatgggacacatcacttatcttgccgaagacggtttaggcaaaaaa
ttcggacgcgatttgcgttccaacggttatcaatacggctttggtgttgaatttgaagtg
gaatcctatcttcgctatcagggcgacaaattcgtcggacggttcgacgccaacacttac
ctgctcatgaccaaggctttggactatttcgatccggcggcagatttcggcgacagcctg
acccgcgccctgcaaaatgtgaaagcgaaattctttgtcgccagcttcagcaccgactgg
cgtttcgcacccgaacgttcgcacgaactggtcaaggcactgattgccgcccaaaaatcc
gtgcagtatatcgaagtcaaatccgcacacgggcacgatgcctttttaatggaagacgaa
gcctatatgcgtgcggtcgccgcctatatgaacaacgtttataaggaatgtcagcaatga

DBGET integrated database retrieval system