KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0942Help
Entry
NMB0942           CDS       T00027                                 

Gene name
rpmE2
Definition
(RefSeq) 50S ribosomal protein L31 type B
  KO
K02909  large subunit ribosomal protein L31
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme03010  Ribosome
Module
nme_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:nme00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NMB0942 (rpmE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nme03011]
    NMB0942 (rpmE2)
Ribosome [BR:nme03011]
 Ribosomal Proteins
  Bacteria
   Large subunit
    NMB0942 (rpmE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L31
Motif
Other DBs
NCBI-GeneID: 903062
NCBI-ProteinID: NP_273980
UniProt: Q9JZQ4
Position
complement(955794..956069)
Genome map
AA seq 91 aa AA seqDB search
MKPNIHPDNYRTVLFFDSSANEGWLIRSCAETHGKTMVWTDGKEYPLFSLDTSSASHPVY
TGKQRNVNTEGRASKFNQRFQSVMSSFRKDK
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgaatattcatcccgacaattaccgaaccgtcctttttttcgatagcagcgcc
aatgaaggctggttaatccgctcctgtgccgaaacacacggaaaaacgatggtttggaca
gacggcaaagaatatccgctgttttcgctggatacttcttccgcatcccatcccgtctat
actggcaaacagcgcaacgtcaacaccgaaggccgtgccagcaaattcaaccaacgtttc
caatccgtaatgtcatcgtttagaaaggacaaataa

DBGET integrated database retrieval system