KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0943Help
Entry
NMB0943           CDS       T00027                                 

Gene name
metF
Definition
(RefSeq) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00670  One carbon pool by folate
nme01100  Metabolic pathways
nme01120  Microbial metabolism in diverse environments
nme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NMB0943 (metF)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     NMB0943 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR Radical_SAM Colicin_Pyocin
Motif
Other DBs
NCBI-GeneID: 903063
NCBI-ProteinID: NP_273981
UniProt: Q9JZQ3
Position
956269..957147
Genome map
AA seq 292 aa AA seqDB search
MNYAKEINALNNSLSDLKGDINVSFEFFPPKNEQMETMLWDSIHRLQTLHPKFVSVTYGA
NSGERDRTHGIVKRIKQETGLEAAPHLTGIDASPDELRQIAKDYWDSGIRRIVALRGDEP
AGYEKKPFYAEDLVKLLRSVADFDISVAAYPEVHPEAKSAQADLINLKRKIDAGANHVIT
QFFFDVERYLRFRDRCVMLGIDVEIVPGILPVTNFKQLGKMAQVTNVKIPSWLSQMYEGL
DDDQGTRNLVAASIAIDMVKVLSREGVKDFHFYTLNRSELTYAICHILGVRP
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgcaaaagaaatcaatgcgttaaataacagcctttccgatttgaaaggcgac
atcaacgtttcattcgaatttttcccgccgaaaaacgaacaaatggaaaccatgctgtgg
gattccatccatcgcctgcaaaccttgcacccgaaatttgtttccgtaacttacggtgca
aactcaggcgagcgcgaccgcacacacggcatcgtcaaacgcatcaaacaggaaaccggc
ttggaagccgcgcctcacctgaccggtatcgacgcttctcccgacgaattgcgccaaatt
gccaaagattattgggacagcggcatccgccgcattgtcgccctgcgcggagacgagccg
gccggttatgagaaaaaaccgttttacgccgaagacttggttaagctattacgctccgtc
gccgacttcgacatctctgtagcagcatatcccgaagtgcatcccgaagcgaaatccgca
caagccgacctgattaatttgaaacgcaaaatcgatgcgggcgcgaaccacgtcatcacc
caattcttcttcgatgtggaacgctacctgcgcttccgcgaccgctgcgtgatgttgggt
atcgatgtggaaatcgtccccggtattttgcctgttaccaacttcaagcagctcggtaaa
atggctcaagtaaccaacgtcaaaatcccaagctggctgtcgcaaatgtatgaaggtttg
gacgacgaccaaggtacgcgcaatctggtggcggcaagtatcgccatcgatatggtcaaa
gtcctgtcccgcgaaggcgtgaaagatttccacttctatacgcttaaccgcagcgagctg
acttacgccatttgccatattttaggcgtgcgcccttaa

DBGET integrated database retrieval system