KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0944Help
Entry
NMB0944           CDS       T00027                                 

Gene name
metH
Definition
(RefSeq) 5-methyltetrahydropteroyltriglutamate/homocysteine S-methyltransferase
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00270  Cysteine and methionine metabolism
nme00450  Selenocompound metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB0944 (metH)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NMB0944 (metH)
Enzymes [BR:nme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     NMB0944 (metH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Meth_synt_2 Meth_synt_1 URO-D SHOCT
Motif
Other DBs
NCBI-GeneID: 903064
NCBI-ProteinID: NP_273982
UniProt: Q9JZQ2
Position
957285..959561
Genome map
AA seq 758 aa AA seqDB search
MTTLHFSGFPRVGAFRELKFAQEKYWRKEISEQELLAVAKDLREKNWKHQVAANADFVAV
GDFTFYDHILDLQVATGAIPARFGFDSQNLSLEQFFQLARGNKDQFAIEMTKWFDTNYHY
LVPEFHADTEFKANAKHYVQQLQEAQALGLKAKPTVVGPLTFLWVGKEKGAVEFDRLSLL
PKLLPVYVEILTALVEAGAEWIQIDEPALAVDLPKEWVEAYKDVYATLSKVSAKILLSTY
FGSVAEHAALLKALPVDGLHIDLVRAPEQLDAFADYDKVLSAGVIDGRNIWRANLNKVLE
TVEPLQAKLGDRLWISSSCSLLHTPFDLSVEEKLKANKPDLYSWLAFTLQKTQELRVLKA
ALNEGRDSVAEELAASQAAADSRANSSEIHRADVAKRLADLPANADQRKSPFADRIKAQQ
AWLNLPLLPTTNIGSFPQTTEIRQARSAFKKGELSAADYEAAMKKEIALVVEEQEKLDLD
VLVHGEAERNDMVEYFGELLSGFAFTQYGWVQSYGSRCVKPPIIFGDVSRPEAMTVAWST
YAQSLTKRPMKGMLTGPVTILQWSFVRNDIPRSTVCKQIALALNDEVLDLEKAGIKVIQI
DEPAIREGLPLKRADWDAYLNWAGESFRLSSAGCEDSTQIHTHMCYSEFNDILPAIAAMD
ADVITIETSRSDMELLTAFGEFQYPNDIGPGVYDIHSPRVPTEAEVEHLLRKAIEVVPVE
RLWVNPDCGLKTRGWKETLEQLQVMMNVTRKLRAELAK
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacatttctcaggcttcccgcgtgtcggcgccttccgcgaattgaaattc
gcacaagaaaaatactggcgcaaagaaatcagcgagcaagaattgctggctgttgctaaa
gacttgcgcgagaaaaactggaaacaccaggtcgctgccaacgccgatttcgttgccgta
ggcgatttcactttctacgaccacatcctcgacctgcaagtcgccaccggcgcgattccc
gcccgcttcggcttcgacagccaaaacctgtctttggaacaattcttccaactggcgcgc
ggtaacaaagaccaattcgctatcgaaatgaccaaatggttcgacaccaactaccactac
ttggtgcctgaattccacgccgataccgaattcaaagccaatgccaaacactatgttcaa
caactgcaagaagcccaagccctcggtctgaaagccaaaccgaccgttgtaggtccgttg
actttcctgtgggtgggtaaagaaaaaggcgccgtcgaattcgaccgtctgagcctgttg
cctaaactgttgcctgtttacgttgaaatcctgactgctttggttgaagccggtgccgag
tggattcaaatcgacgagcctgctttggctgtcgatttgcctaaagaatgggtggaagcc
tacaaagacgtttacgctactttgagcaaagtaagtgccaaaatcctgttgagcacttac
ttcggttctgttgccgaacacgccgcattgttgaaagccctgcctgttgacggtctgcac
atcgacttggtacgcgcccccgagcaactggacgcgttcgccgactacgacaaagtcctg
tctgccggcgtgattgacggccgcaacatttggcgcgccaacctgaacaaagttttggaa
actgtcgagcctctgcaagccaaactgggtgaccgtttgtggatttccagctcttgctcg
ctgctgcacactccatttgacttgtcagttgaagaaaaactgaaagccaacaaacccgac
ctgtactcttggttggcattcaccctgcaaaaaacccaagaattgcgcgttctgaaagct
gcattgaacgaaggccgtgattctgttgccgaagaactcgccgccagccaagctgctgcc
gactcccgtgccaacagcagcgaaatccatcgtgcagacgttgccaaacgcctggccgat
ttgcctgccaacgcagaccaacgcaaatctccatttgccgaccgtatcaaagcgcaacaa
gcatggttgaacctacctctgctaccgactaccaacatcggttctttcccgcaaaccacc
gaaatccgccaggcacgctcagccttcaaaaaaggcgaactgtctgccgccgattacgaa
gccgcgatgaaaaaagaaatcgccttggtggttgaagagcaagaaaaactggacttggac
gtactggtacacggcgaagccgagcgtaacgacatggttgaatacttcggcgaattgttg
agcggttttgcattcactcaatacggctgggtacaaagctacggctcacgctgcgtgaaa
ccaccgattatctttggcgacgtaagccgtcctgaagccatgaccgtggcttggtctact
tacgcacaaagcctgaccaaacgcccgatgaaaggtatgttgaccggccctgtaaccatt
ctgcaatggtctttcgtccgcaacgacattcctcgctctaccgtgtgcaaacaaatcgca
ctggctctgaacgacgaagtattggatctggaaaaagccggcatcaaagtcatccaaatt
gacgaacctgccatccgcgaaggcttgccgctgaaacgcgccgattgggatgcctacctg
aactgggcgggcgaatccttccgcctgtcctctgccggttgcgaagacagcacccaaatc
cacactcatatgtgttactccgagttcaacgatatcctgcctgcgattgctgcaatggat
gcggacgtgatcaccatcgagacttcacgttccgacatggaactcttgaccgcgttcggc
gaattccaatacccgaacgacatcggcccgggggtttacgacatccacagcccgcgcgta
ccgacagaagccgaagtggagcacctgttgcgcaaagccatcgaggttgtaccggttgaa
cgtctgtgggttaacccggactgcggcctgaaaacacgcggctggaaagaaactctggaa
caactccaagtaatgatgaacgtaacccgaaaactgcgtgccgaattggcgaaataa

DBGET integrated database retrieval system