KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0947Help
Entry
NMB0947           CDS       T00027                                 

Definition
(RefSeq) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00010  Glycolysis / Gluconeogenesis
nme00020  Citrate cycle (TCA cycle)
nme00260  Glycine, serine and threonine metabolism
nme00280  Valine, leucine and isoleucine degradation
nme00620  Pyruvate metabolism
nme00630  Glyoxylate and dicarboxylate metabolism
nme00640  Propanoate metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
Module
nme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nme_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB0947
   00020 Citrate cycle (TCA cycle)
    NMB0947
   00620 Pyruvate metabolism
    NMB0947
   00630 Glyoxylate and dicarboxylate metabolism
    NMB0947
   00640 Propanoate metabolism
    NMB0947
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB0947
   00280 Valine, leucine and isoleucine degradation
    NMB0947
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nme04147]
    NMB0947
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     NMB0947
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NMB0947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox_3 GIDA Pyr_redox AlaDh_PNT_C HI0933_like K_oxygenase DAO FAD_binding_2 Thi4 FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 903067
NCBI-ProteinID: NP_273985
UniProt: Q9JZQ0
Position
960826..962229
Genome map
AA seq 467 aa AA seqDB search
MKKIQADVVVIGGGTAGMGAFRNARLHSDNVYLIENNVFGTTCARVGCMPSKLLIAAAEA
RHHALHTDPFGVHLDKDSIVVNGEEVMQRVKSERDRFVGFVVADVEEWPADKRIMGSAKF
IDEHTVQIDEHTQITAKSFVIATGSRPVILPQWQSLGNRLIINDDVFSWDTLPKRVAVFG
PGVIGLELGQALHRLGVKVEIFGLGGIIGGISDPVVSDEANAVFGEELKLHLDAKTEVKL
DADGNVEVHWEQDGEKGVFVAEYMLAAVGRRPNVDNIGLENINIEKDARGVPVADPLTMQ
TSIPHIFIAGDASNQLPLLHEAADQGKIAGDNAGRYPNIGGGLRRSTIGVVFTSPQIGFV
GLKYAQVAAQYQADEFVIGEVSFKNQGRSRVMLVNKGHMRLYAEKATGRFIGAEIVGPAA
EHLAHLLAWAHQMKMTVPQMLDMPFYHPVIEEGLRTALRDADAKLKA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattcaagcggatgtcgtcgtaatcggcggcggtactgccggtatgggtgcg
tttcgcaatgcccgtttacattcggataatgtttacctgattgaaaacaatgtgttcggc
acgacctgcgcgcgcgtgggctgtatgccttccaaactcttgattgccgccgcagaggcg
cgtcatcacgcattgcataccgacccgttcggcgtgcatttggacaaagacagcatcgtc
gtcaacggtgaagaggtcatgcagcgcgttaaatccgagcgtgaccgttttgtcggcttt
gtcgttgccgatgtggaagagtggcctgccgacaagcgcattatgggttcggctaaattt
atcgacgagcataccgtccaaatcgacgagcatactcaaattacggcaaaaagtttcgtg
attgctaccggttcgcgtcccgtcatcctgccgcaatggcagtctttgggcaatcgtttg
attatcaacgatgacgttttctcatgggatacgctgcctaagcgcgttgccgtgttcggg
ccgggtgttatcggtttggaactgggtcaggcattgcaccgtttgggcgtgaaagttgaa
attttcggtttgggcggaatcatcggcggcatttccgaccccgtcgtttcagacgaggcg
aacgccgtgttcggcgaagaattgaaactgcatctggatgctaaaaccgaggtcaaactc
gatgcagacggcaatgtagaagtccattgggagcaggatggcgaaaaaggcgtatttgtt
gccgaatatatgctggcagccgtgggccgccgtccgaacgttgacaatatcggtttggaa
aatatcaatatcgaaaaagatgcgcgcggcgtacctgttgccgacccgctgaccatgcag
accagtattccgcatatcttcatcgcaggcgatgcgtccaaccaactgcctctgctgcat
gaagctgccgaccaaggcaagattgccggcgataacgcgggccgctacccgaatatcggc
ggcggtttgcggcgcagcaccatcggcgtggtgtttaccagtccgcaaatcggctttgtc
ggtctgaaatacgcgcaggttgccgcgcaataccaagccgacgaatttgtcatcggcgaa
gtatcgttcaaaaaccaaggccgcagccgcgtgatgctggtgaacaaaggccatatgcgc
ctgtatgccgaaaaagccaccggccgctttatcggcgcggaaatcgtaggccctgccgcc
gaacatttggcgcacctgttggcttgggcacatcaaatgaagatgaccgttccgcaaatg
ctggatatgccgttctaccatcccgttatcgaggaaggtctgcgtaccgcgttgcgcgat
gccgatgcgaaattgaaagcctga

DBGET integrated database retrieval system