KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0950Help
Entry
NMB0950           CDS       T00027                                 

Gene name
sdhA
Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00020  Citrate cycle (TCA cycle)
nme00190  Oxidative phosphorylation
nme00650  Butanoate metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
Module
nme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nme_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMB0950 (sdhA)
   00650 Butanoate metabolism
    NMB0950 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NMB0950 (sdhA)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NMB0950 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     NMB0950 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 GIDA Lycopene_cycl Pyr_redox_3 HI0933_like NAD_binding_8 NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 903070
NCBI-ProteinID: NP_273988
UniProt: Q9JZP8
Position
963223..964986
Genome map
AA seq 587 aa AA seqDB search
MGFPVRKFDAVIVGGGGAGLRAALQLSKSGLNCAVLSKVFPTRSHTVAAQGGISASLGNV
QEDRWDWHMYDTVKGSDWLGDQDAIEFMCRAAPEAVIELEHMGMPFDRVESGKIYQRPFG
GHTAEHGKRAVERACAVADRTGHAMLHTLYQQNVRANTQFFVEWTAQDLIRDENGDVVGV
TAMEMETGEVYIFHAKAVMFATGGGGRIYASSTNAYMNTGDGLGICARAGIPLEDMEFWQ
FHPTGVAGAGVLITEGVRGEGGILLNADGERFMERYAPTVKDLASRDVVSRAMAMEIYEG
RGCGKNKDHVLLKIDHIGAEKIMEKLPGIREISIQFAGIDPIKDPIPVVPTTHYMMGGIP
TNYHGEVVVPQGEDYEVPVKGLYAAGECACASVHGANRLGTNSLLDLVVFGKAAGDSMIK
FIKEQSDWKPLPANAGELTRQRIERLDNQTDGENVDALRRELQRSVQLHAGVFRTDEILS
KGVREVMAIAERVKRTEIKDKSKVWNTARIEALELDNLIEVAKATLVSAEARKESRGAHA
SDDHPERDDENWMKHTLYHSDINTLSYKPVHTKPLSVEYIKPAKRVY
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcctgttcgcaagtttgatgccgtgattgtcggcggtggtggtgcaggttta
cgcgcagccctccaattatccaaatccggtctgaattgtgccgttttgtctaaagtgttc
ccgacccgttcgcataccgtagcggcgcagggcggtatttccgcctctctgggtaatgtg
caggaagaccgttgggactggcacatgtacgataccgtgaaaggttccgactggttgggc
gaccaagatgcgattgagtttatgtgccgcgccgcgcctgaagccgtaattgagttggaa
cacatgggtatgccttttgaccgtgtggaaagcggtaaaatttatcagcgtcctttcggc
ggccatactgccgaacacggtaaacgcgcggtagaacgcgcctgtgcggttgccgaccgt
acaggtcatgcgatgctgcatactttgtaccaacaaaacgtccgtgccaatacgcaattc
tttgtggaatggacggcacaagatttgattcgtgatgaaaacggcgatgtcgtcggcgta
accgccatggaaatggaaaccggcgaagtttatattttccacgctaaagctgtgatgttt
gctaccggcggcggcggtcgtatttatgcgtcttctaccaatgcctatatgaataccggc
gatggtttgggtatttgtgcgcgtgcaggtatcccgttggaagacatggaattctggcaa
ttccacccgaccggcgtggcgggtgcgggcgtgttgattaccgaaggcgtacgcggcgag
ggcggtattctgttgaatgccgacggcgaacgctttatggaacgctatgcgccgaccgta
aaagacttggcttctcgcgacgttgtttcccgcgcgatggcgatggaaatctacgaaggt
cgcggctgcggtaaaaacaaagaccatgtcttactgaaaatcgaccatatcggcgcagaa
aaaattatggaaaaactgccgggcatccgcgagatttccattcagttcgccggtatcgat
ccgattaaagacccgattcccgttgtgccgactacccactatatgatgggcggcattccg
accaattaccacggcgaagttgtcgttccgcaaggtgaagattacgaagtgcctgtaaaa
ggtctgtatgcggcaggtgagtgcgcttgtgcttccgtacacggtgcgaaccgcttgggt
accaactccctgttggacttggtggtattcggtaaagctgccggcgacagcatgattaaa
ttcatcaaagagcaaagcgactggaaacctttgcctgctaatgcaggtgagttgacccgc
caacgtatcgagcgtttggacaaccaaaccgatggtgaaaacgttgatgcattgcgtcgc
gaactgcaacgctctgtacaactgcacgccggcgtgttccgtactgatgagattctgagc
aaaggcgttcgagaagtcatggcgattgccgagcgtgtgaaacgtaccgaaatcaaagac
aagagcaaagtgtggaataccgcgcgtatcgaggctttggaattggataacctgattgaa
gtggcgaaagcgactttggtgtctgccgaagcacgtaaagaatcacgcggtgcgcacgct
tcagacgaccatcctgagcgcgatgatgaaaactggatgaaacatacgctgtaccattca
gatatcaataccttgtcctacaaaccggtgcacaccaagcctttgagcgtggaatacatc
aaaccggccaagcgcgtttattga

DBGET integrated database retrieval system