KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0957Help
Entry
NMB0957           CDS       T00027                                 

Gene name
lpdA1
Definition
(RefSeq) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00010  Glycolysis / Gluconeogenesis
nme00020  Citrate cycle (TCA cycle)
nme00260  Glycine, serine and threonine metabolism
nme00280  Valine, leucine and isoleucine degradation
nme00620  Pyruvate metabolism
nme00630  Glyoxylate and dicarboxylate metabolism
nme00640  Propanoate metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
Module
nme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nme_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB0957 (lpdA1)
   00020 Citrate cycle (TCA cycle)
    NMB0957 (lpdA1)
   00620 Pyruvate metabolism
    NMB0957 (lpdA1)
   00630 Glyoxylate and dicarboxylate metabolism
    NMB0957 (lpdA1)
   00640 Propanoate metabolism
    NMB0957 (lpdA1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB0957 (lpdA1)
   00280 Valine, leucine and isoleucine degradation
    NMB0957 (lpdA1)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     NMB0957 (lpdA1)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NMB0957 (lpdA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox FAD_binding_2 Pyr_redox_3 AlaDh_PNT_C FAD_oxidored GIDA NAD_binding_8 K_oxygenase HI0933_like 3HCDH_N FAD_binding_3 Thi4 Lycopene_cycl 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 903077
NCBI-ProteinID: NP_273995
UniProt: Q9JZP5
Position
972139..973572
Genome map
AA seq 477 aa AA seqDB search
MSQYDVVVIGAGPGGYVAAIRAAQLGFKTACVDAGVNKAGNAPALGGTCLNVGCIPSKAL
LQSSEHFHAAQHEFAEHGITVGDVKFDAAKMIERKDAIVTKLTGGVKFLFQKNKVTSLFG
TASFAGKNGDAYQIEVDNKGEKTVIEAKHVIVATGSVPRPLPQVAIDNVNVLDNEGALNL
TEVPAKLGVIGSGVIGLEMGSVWNRVGAEVTILEAAPTFLAAADQQIAKEAFKYFTKEQG
LSIELGVKIGDIKSEGKGVSVAYETAAGEAKTEVFDKLIVAIGRIPNTKGLNAEAVGLEK
DERGFIKVDGECRTNLPNVWAIGDVVRGPMLAHKASDEGVAVAERIAGQKPHIDFNNVPF
VIYTDPEIAWVGKTEEQLKAEGVEYKKGTSGFGANGRALAMGKAKGTVKVLADAKTDRIL
GVHMIGPVVSELVTEGVTALEFFASSEDIARIIHAHPTLSEVVHEAALAADKRALHG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaatatgatgtagtagtgattggtgcaggcccgggtggatacgttgccgccatc
cgtgccgcgcaactgggtttcaaaaccgcttgcgtcgatgcaggcgttaacaaagcaggc
aatgcccctgcattgggcggtacttgcttgaacgtaggctgtatcccttctaaagccctg
ttgcaatccagcgaacatttccacgctgcgcaacacgagtttgccgaacacggtatcact
gtcggcgacgtaaaattcgacgcggccaaaatgattgagcgcaaagatgccatcgtgacc
aagctgaccggcggcgtcaaattcctgttccaaaaaaataaagtaaccagcctgttcggt
acggcttcctttgccggtaaaaatggcgatgcttaccaaatcgaagtcgataacaaaggc
gagaaaaccgttatcgaagccaaacacgtcatcgtagccaccggttccgtaccgcgtccg
ctgccacaagtcgctatcgacaatgtgaacgtattggacaacgaaggtgcattgaacctg
accgaagtacctgccaaactcggcgtgatcggttccggcgtgattggtttggaaatgggt
tccgtatggaaccgcgtgggtgcggaagttaccattcttgaagccgcgccgactttcctg
gctgccgccgaccaacaaatcgccaaagaagccttcaaatacttcaccaaagagcaaggt
ctgagcatcgaattgggcgtgaaaatcggcgacatcaagtctgaaggcaaaggtgtttcc
gttgcttacgaaactgctgctggcgaagccaaaaccgaagtattcgacaaactgatcgtt
gccatcggccgtattccaaacaccaaaggcctgaacgcggaagccgtaggcttggaaaaa
gacgagcgcggctttatcaaagtagatggcgaatgccgtaccaacctgcctaacgtatgg
gcaatcggcgacgtggttcgcggcccgatgttggcacacaaagccagcgacgaaggcgtt
gccgttgccgaacgcattgccggtcaaaaaccgcatatcgacttcaacaacgtaccgttc
gtgatttacaccgatcctgaaatcgcttgggtgggtaaaaccgaagagcagctcaaagcc
gaaggcgtggagtacaaaaaaggtacttcaggttttggtgcgaatggtcgcgcattggca
atgggcaaagccaaaggtacggttaaagtgttggcagatgccaaaaccgaccgcatcttg
ggcgtacacatgattggtccggttgtcagcgaattggttaccgaaggcgtgactgcgctc
gaattcttcgccagcagcgaagacatcgcccgcattatccatgcccacccaaccttgtcc
gaagtggttcacgaagctgcattggcggccgacaaacgcgctttgcacggttga

DBGET integrated database retrieval system