KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0964
Entry
NMB0964           CDS       T00027                                 

Name
(GenBank) TonB-dependent receptor
  KO
K02014  iron complex outermembrane recepter protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nme02000]
    NMB0964
Transporters [BR:nme02000]
 Other transporters
  Pores ion channels [TC:1]
   NMB0964
SSDB
Motif
Pfam: TonB_dep_Rec Plug OMP_b-brl_3
Other DBs
NCBI-ProteinID: AAF62323
UniProt: Q9JZN9
Structure
PDB: 
4RDR 4RDT 4RVW

Position
complement(983265..985541)
AA seq 758 aa
MAQTTLKPIVLSILLINTPLLAQAHETEQSVDLETVSVVGKSRPRATSGLLHTSTASDKI
ISGDTLRQKAVNLGDALDGVPGIHASQYGGGASAPVIRGQTGRRIKVLNHHGETGDMADF
SPDHAIMVDTALSQQVEILRGPVTLLYSSGNVAGLVDVADGKIPEKMPENGVSGELGLRL
SSGNLEKLTSGGINIGLGKNFVLHTEGLYRKSGDYAVPRYRNLKRLPDSHADSQTGSIGL
SWVGEKGFIGVAYSDRRDQYGLPAHSHEYDDCHADIIWQKSLINKRYLQLYPHLLTEEDI
DYDNPGLSCGFHDDDNAHAHTHSGRPWIDLRNKRYELRAEWKQPFPGFEALRVHLNRNDY
RHDEKAGDAVENFFNNQTQNARIELRHQPIGRLKGSWGVQYLQQKSSALSAISEAVKQPM
LLDNKVQHYSFFGVEQANWDNFTLEGGVRVEKQKASIQYDKALIDRENYYNHPLPDLGAH
RQTARSFALSGNWYFTPQHKLSLTASHQERLPSTQELYAHGKHVATNTFEVGNKHLNKER
SNNIELALGYEGDRWQYNLALYRNRFGNYIYAQTLNDGRGPKSIEDDSEMKLVRYNQSGA
DFYGAEGEIYFKPTPRYRIGVSGDYVRGRLKNLPSLPGREDAYGNRPFIAQDDQNAPRVP
AARLGFHLKASLTDRIDANLDYYRVFAQNKLARYETRTPGHHMLNLGANYRRNTRYGEWN
WYVKADNLLNQSVYAHSSFLSDTPQMGRSFTGGVNVKF
NT seq 2277 nt   +upstreamnt  +downstreamnt
atggcacaaactacactcaaacccattgttttatcaattcttttaatcaacacacccctc
ctcgcccaagcgcatgaaactgagcaatcggtggatttggaaacggtcagcgtcgtcggc
aaaagccgtccgcgcgccacgtcggggctgttgcacacttcgaccgcctccgacaaaatc
atctccggcgataccttgcgccaaaaagccgtcaacttgggcgacgctttagacggcgta
ccgggcatccacgcttcgcaatacggcggcggcgcgtctgctcccgtcattcgcggtcaa
acaggcaggcggattaaagtgttgaaccatcacggcgaaacaggcgatatggcggatttt
tcgcccgatcacgccattatggtagataccgccttgtcgcaacaggtcgaaatcctgcgc
gggccggttacgctcttgtacagctcgggcaatgtggcggggctggtcgatgttgccgat
ggcaaaatccccgaaaaaatgcctgaaaacggcgtatcgggcgaactcggattgcgtttg
agcagcggcaatctggaaaaactcacgtccggcggcatcaatatcggtttgggcaaaaac
tttgtattgcacacggaagggctgtaccgcaaatcgggggattacgccgtaccgcgttac
cgcaatctgaaacgcctgcccgacagccacgccgattcgcaaacgggcagcatcgggctg
tcttgggttggcgaaaaaggttttatcggcgtagcgtacagcgaccgtcgcgaccaatat
ggtctgcctgcccacagccacgaatacgatgattgccacgccgacatcatctggcaaaag
agcttgattaacaaacgctatttacagctttatccgcacctgttgaccgaagaagacatc
gattacgacaatccgggcttgagctgcggcttccacgacgacgataatgcacacgcacac
acccacagcggcagaccgtggatagacctgcgcaacaaacgctacgaactccgtgccgaa
tggaagcaaccgttccccggttttgaagccctgcgcgtacacctgaaccgcaacgactac
cgccacgacgaaaaagcaggcgatgcagtcgaaaacttttttaacaaccaaacgcaaaac
gcccgcatcgagttgcgccaccaacccataggtcgtctgaaaggcagctggggcgtgcaa
tatttacaacaaaaatccagtgctttatctgccatatccgaagcggttaaacaaccgatg
ctgcttgacaacaaagtgcaacattacagctttttcggtgtagaacaggcaaactgggac
aacttcacgcttgaaggaggcgtacgcgtggaaaaacaaaaagcctccattcagtacgac
aaagcattgattgatcgggaaaactactacaaccaccccctgcccgacctcggcgcgcac
cgccaaaccgcccgctcattcgcactttcgggcaactggtatttcacgccacaacacaaa
ctcagcctgaccgcctcccatcaggaacgcctgccgtcaacgcaagagctgtacgcacac
ggcaaacacgtcgccaccaacacctttgaagtcggcaacaaacacctcaacaaagagcgt
tccaacaatatcgaactcgcgctgggctacgaaggcgaccgctggcaatacaatctggca
ctctaccgcaaccgcttcggtaactacatttacgcccaaaccttaaacgacggacgcggc
cccaaatccatcgaagacgacagcgaaatgaagctcgtgcgctacaaccaatccggcgcc
gacttctacggcgcggaaggcgaaatctacttcaaaccgacaccgcgctaccgcatcggc
gtttccggcgactatgtacgaggccgtctgaaaaacctgccttccctacccggcagagaa
gatgcctacggcaaccgtcctttcatcgcacaggacgaccaaaatgccccccgtgttccg
gctgcgcgcctcggcttccacctgaaagcctcgctgaccgaccgtatcgatgccaatttg
gactactaccgcgtgttcgcccaaaacaaactcgcccgctacgaaacgcgcacgcccgga
caccatatgctcaacctcggcgcaaactaccgccgcaatacgcgctatggcgagtggaat
tggtacgtcaaagccgacaacctgctcaaccaatccgtttacgcccacagcagctttctc
tctgatacgccgcaaatgggccgcagctttaccggcggcgtgaacgtgaagttttaa

DBGET integrated database retrieval system