KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0965Help
Entry
NMB0965           CDS       T00027                                 

Definition
(RefSeq) hypothetical protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 903085
NCBI-ProteinID: NP_274003
UniProt: Q9JZN8
Position
complement(985599..985871)
Genome map
AA seq 90 aa AA seqDB search
MRPREPGAEPRVLTSTPFCHLFDRSGTCRFYALINFGYPAAEHNGQTQRNLRQHQPRPRR
TADTNGHRPMPQPFHLKNFCLCPLSVLKIL
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgcgccctcgtgaacctggcgcagagcctcgcgttctgacaagtacgccattttgccac
cttttcgaccgttcgggaacgtgccgtttttatgcactcataaattttggttatcccgca
gccgaacataatgggcaaacacagcggaatctgcgtcaacatcaaccgcgcccccgaagg
acggcggatacaaatggacaccgcccgatgccgcaaccgtttcatttgaaaaacttttgc
ctatgccctctgagtgttctcaaaatcttatga

DBGET integrated database retrieval system