KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0978Help
Entry
NMB0978           CDS       T00027                                 

Gene name
pntB
Definition
(RefSeq) pyridine nucleotide transhydrogenase
  KO
K00325  H+-translocating NAD(P) transhydrogenase subunit beta [EC:1.6.1.2 7.1.1.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00760  Nicotinate and nicotinamide metabolism
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NMB0978 (pntB)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.1  With NAD+ or NADP+ as acceptor
    1.6.1.2  NAD(P)+ transhydrogenase (Re/Si-specific)
     NMB0978 (pntB)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.1  proton-translocating NAD(P)+ transhydrogenase
     NMB0978 (pntB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNTB TPP_enzyme_M
Motif
Other DBs
NCBI-GeneID: 903098
NCBI-ProteinID: NP_274015
UniProt: Q9JZN2
Position
complement(992395..993780)
Genome map
AA seq 461 aa AA seqDB search
MSSGLVTAAYIVAAILFIFSLAGLSKQETAKQGCYSGIAGMAVALFVTVFSDNTHGLGWI
IIAMLIGAAIGIYKAKKVEMTEMPELIALLHSFVGLAAVLVGFNSYIAPGNVSHDMHTIH
LVEVYLGIFIGAVTFTGSLVAFGKLNGKISSSPLQLPAKHKLNALALAVSFVLLLVFVGI
DGSGFILLIMTLIALAFGWHLVASIGGADMPVVVSMLNSYSGWAAAAAGFMLSNDLLIVT
GALVGSSGAILSYIMCKAMNRSFVSVIAGGFGSDSGTLSSGSQEIGEYREVKAADIAEML
KGANNVIITPGYGMAVAQAQYPVAEITELLRKNGTEVRFGIHPVAGRLPGHMNVLLAEAK
VPYDIVLEMDEINDDFPETDVVLVIGANDTVNPAAQTDPNSPIAGMPVLEVWKAKEVVVF
KRSMNTGYAGVQNPLFFNENSVMCFGDAKKTVDDILSELKK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaggactcgtaacagcggcgtatatcgttgccgcaattttattcatcttctca
ctggcggggctgtccaaacaggaaaccgccaaacagggctgctattccggtatcgccggt
atggcggtcgccctttttgtaactgttttttccgacaatacccacggactgggctggatc
atcatcgccatgctcatcggcgcggcaatcggcatctacaaagccaaaaaggtggaaatg
accgaaatgcccgaactgattgccctgctgcacagcttcgtcggcctagcggcggttttg
gtcggcttcaacagctatatcgcgccgggcaacgtttcgcacgatatgcacaccatccat
ctggtcgaagtgtatttaggcatcttcatcggcgcggtaacctttaccggctcgctggtc
gcattcggcaaactcaacggcaaaatcagcagcagcccgctgcaactgcccgccaaacac
aagctcaacgcactggcacttgccgtatcgtttgtgttgctgctcgtatttgtcggcatt
gacggcagcggcttcatcctgctgattatgaccctgattgccctcgcattcggctggcac
ttggttgcctccatcggcggcgcagatatgcccgtggtcgtgtccatgctcaactcctac
tccggctgggcggccgcagcggcaggcttcatgctctccaacgacctgctcatcgttacc
ggcgcgctggtcggctcaagcggcgcgattctgtcctacattatgtgcaaagccatgaac
cgctcgtttgtctcggtaattgccggtggtttcggcagcgacagcggcacattatcttcc
ggcagccaagagataggggaataccgagaagtcaaagctgccgatattgccgaaatgctg
aaaggcgcaaacaatgtcatcattaccccgggctacggtatggcagtcgcacaagcgcaa
taccccgttgccgaaatcaccgagcttttacgtaaaaacggcaccgaagtacgcttcggc
atccaccccgtcgccggccgcctgcccggtcatatgaacgtactgctcgccgaagccaaa
gtcccctacgacatcgttttggaaatggacgaaatcaacgacgacttccccgaaaccgat
gtggtcttggtcatcggtgcgaacgacaccgtcaaccccgccgcccaaaccgacccgaac
agcccgattgcgggtatgcccgtgttggaagtgtggaaggcaaaagaagtcgtcgtcttc
aaacgctcgatgaataccggctacgcaggtgtacaaaacccactgttcttcaacgaaaac
agcgtgatgtgtttcggagatgcgaagaaaaccgtagatgacattctgtccgaactgaaa
aaataa

DBGET integrated database retrieval system