KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0981Help
Entry
NMB0981           CDS       T00027                                 

Gene name
serB
Definition
(RefSeq) phosphoserine phosphatase
  KO
K01079  phosphoserine phosphatase [EC:3.1.3.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00260  Glycine, serine and threonine metabolism
nme00680  Methane metabolism
nme01100  Metabolic pathways
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
nme01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    NMB0981 (serB)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB0981 (serB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nme01009]
    NMB0981 (serB)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     NMB0981 (serB)
Protein phosphatases and associated proteins [BR:nme01009]
 HAD phosphatases
  Other HAD phosphatases
   NMB0981 (serB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD Hydrolase Hydrolase_3 HAD_2 Put_Phosphatase S6PP
Motif
Other DBs
NCBI-GeneID: 903101
NCBI-ProteinID: NP_274018
UniProt: Q9JZM9
Position
996078..996911
Genome map
AA seq 277 aa AA seqDB search
MPHALVLQFPSAAALPSDFPLRLPEPDCADEKRMRFIVEEGFSLSEKDAALLGSRQIDHA
VLPDMDFDELGLIVSDMDSTLITIECVDEIAAGVGLKNKVAEITERSMRGELDFEQSLRS
RVALLAGLDERVLADVYENVLKLSPGAEFLLDECKRHDVKFLLVSGGFTFFTERLQQRLG
FEYQHANVLEIENGRLTGRLKGRIIDAQAKADLLREYRSRLGLQPHQVLAVGDGANDIPM
LKEAGIGVAYRAKPKARAAADACINFGGLERVRGLFG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgccgcacgccctcgtcctccaatttccctccgccgcagccctgccttccgacttcccc
ttacgcctgcccgaacctgattgcgccgatgaaaagcgtatgcgttttatcgttgaagaa
gggttttctttaagcgaaaaagacgcggcgttgcttggcagccgtcaaatcgaccacgcc
gtgttgccggatatggatttcgacgaactcggtttgattgtcagcgatatggattcgacg
ctgattaccatcgaatgcgtcgatgaaattgcggcaggcgtgggtttaaaaaacaaagta
gcggaaattaccgagcgttcgatgcgcggcgaactcgatttcgaacagtctttacgcagc
cgcgtcgcgctgttggcgggattggacgaacgggttttggcggacgtttatgaaaacgtt
ttgaagctctcgcccggtgcggaatttttgttggacgaatgcaaaaggcacgatgtgaaa
ttcctgctggtgtcgggcggcttcacgttttttaccgaaaggctgcaacaacgcctcggc
ttcgaataccaacacgccaatgttttggaaattgaaaacggcaggctgaccggccgtctg
aaaggcagaatcatcgacgcgcaggcaaaggcagatttgttgcgcgaataccgcagccgc
ctcggattgcagccgcatcaggtgttggcggtgggcgacggtgcgaacgatattccgatg
ctcaaagaagcgggcataggcgtggcttaccgtgccaaaccgaaagcgcgggccgccgcc
gatgcctgtatcaacttcggcggtttggagcgtgtacgcggcctgttcggatag

DBGET integrated database retrieval system