KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0982Help
Entry
NMB0982           CDS       T00027                                 

Definition
(RefSeq) chloride channel protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Voltage_CLC
Motif
Other DBs
NCBI-GeneID: 903102
NCBI-ProteinID: NP_274019
UniProt: Q9JZM8
Position
997056..998198
Genome map
AA seq 380 aa AA seqDB search
MHFIQHTAYGYGADGVYTSFREGVAQASGMRRVAVLTLCGAVAGSGWWLLKRFGKPQIEI
KAALKQPLQGLPFLTTVFHVLLQIITVGLGSPLGREVAPREMTAAFAFAGGKRLGLDEGE
MRLLIACASGAGLAAVYNVPLASTLFILEAMLGVWTQQAVAAALLTSVIATAVARIGLGD
VQQYHPANLTVNTSLLWFSAVIGPILGVAAVFFQRTAQKFPFIKRDNIKIIPLAVCMFAL
IGVISVWFPEILGNGKAGNQLTFGGLTDWQHSLGLTAVKWLVVLMALAVGAYGGLITPSM
MLGSTIAFAAATAWNSVFPEMSSESAAIVGAAVFLGVSLKMPLTAIAFILELTYAPVALL
MPLCTGMAGAVWVAKKMGFK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcatacagcatacggcatacggttatggcgcggacggcgtgtacacttcgttc
cgcgaaggcgtggcacaggcttccggtatgcggcgcgttgccgtgctgacgctgtgcggc
gcggtcgcaggcagcggctggtggttgctgaaacgtttcggcaagccgcaaatcgaaatc
aaagccgccttgaaacagccgttgcaggggctgccgtttctgacgacggttttccatgtt
ctgctgcaaatcataacggtcggactcggttcgccgctcggacgcgaagtcgccccgcgc
gaaatgaccgccgcgtttgcttttgccggcggcaaacgcttgggtttggatgaaggcgaa
atgcggctactgattgcttgcgcttcgggtgcgggtttggcggccgtgtataacgtgccg
ctcgcctccacacttttcattctcgaagccatgctgggcgtgtggacgcagcaagccgtc
gccgctgcattgttaacttcagtcatcgccaccgccgtcgcgcgcatcggcttgggcgac
gtgcagcaatatcatccggccaaccttaccgtcaatacttcattactttggttttccgcc
gtcatcggcccgatactgggcgtagccgccgtctttttccagcgtaccgcccaaaagttc
ccctttatcaagcgcgacaatatcaaaattattcccttggccgtctgtatgtttgcactc
atcggcgtgatttccgtttggtttcccgaaattttgggcaatggcaaagcaggcaatcaa
ctgacctttggcggattgaccgattggcaacacagccttgggctgaccgccgtcaaatgg
ctggtcgtcttaatggcgcttgccgtcggcgcatacggcggtctgattaccccgtccatg
atgctcggcagtaccatcgcctttgctgctgccaccgcgtggaacagtgtttttcctgaa
atgtcctctgaaagcgcagccattgtcggcgccgcagttttcctcggtgtttcccttaaa
atgcccctgaccgccatagcctttattttggagctcacctacgcccctgttgccttgctc
atgccattatgtacaggcatggcaggtgcagtatgggtggcaaagaaaatgggatttaaa
tag

DBGET integrated database retrieval system