KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0983Help
Entry
NMB0983           CDS       T00027                                 

Gene name
purH
Definition
(RefSeq) bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00230  Purine metabolism
nme00670  One carbon pool by folate
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
Module
nme_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NMB0983 (purH)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NMB0983 (purH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nme04147]
    NMB0983 (purH)
Enzymes [BR:nme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     NMB0983 (purH)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     NMB0983 (purH)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NMB0983 (purH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AICARFT_IMPCHas MGS
Motif
Other DBs
NCBI-GeneID: 903103
NCBI-ProteinID: NP_274020
UniProt: Q9JZM7
Position
998362..999942
Genome map
AA seq 526 aa AA seqDB search
MSSIKRALISLSDKTGAVEFAQTLHKLGVEILSTGGTAKLLADAGVPVIEVADYTGFPEM
LDGRVKTLHPKIHGGILGRRDLDEHVAKMEEHGIGNIDLVCVNLYLFAATIAKPNCTLED
AIENIDIGGPTMVRSAAKNWKHVAIVTDTADFPAIAAELEANNGALSDKTRFNLSRKAFS
HTAQYDGMISNYLTSLSDDVLSGTPEIAGFPGRFNQSWIKVQDMRYGENPHQRAAFYRDI
DPAAGSLAAYKQLQGKELSYNNIADADAAWEAVKSFDVPACVIVKHANPCGVAIASNTLD
AYKLAYATDTTSAFGGIIAFNREVDGATVKQITDNQFMEVLMAPKFTAEALEIAAAKKNV
RVLEVPLEAGANRFELKRVGGGLLVQTPDIHRISRADLKVVSKRQPTEQEWNDLLFVWNV
AKYVKSNAIVFGKGGQTYGIGAGQMSRVDSTRIAARKAQDAGLDLNGACAASDAFFPFRD
GVDVIAEQGIKAIIHPAGSMRDQEVFDAADEHGIAMVVTGIRHFRH
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccatcaaacgcgccctgatcagcctatccgacaagacaggcgcagtcgaattt
gcccaaaccctgcacaaactcggtgtcgaaattctttctaccggcggtacagcaaaactc
ttggctgatgcaggcgttcccgttatcgaagttgccgactataccggttttcccgaaatg
ctcgacggccgcgtgaaaaccctgcatccgaaaatccacggcggtattctcggtcgtcgc
gatttggacgaacacgtcgccaagatggaagaacacggcatcggcaatatcgacctcgtg
tgcgtcaacctctacctcttcgctgccaccatcgccaaaccaaactgcacgctggaagac
gcgattgaaaacatcgacatcggcggcccgaccatggtgcgctctgccgcgaaaaactgg
aaacacgtcgccatcgttaccgacaccgccgatttcccggccatagctgccgaactcgaa
gccaacaacggcgcattgagcgacaaaacccgtttcaacctctcgcgcaaagcattcagc
cataccgcccaatacgacggtatgatttccaattacctgacctcgctttcagacgacgtc
ttgagcggcacgcccgaaatcgccggattccccggccggttcaatcaaagctggattaaa
gtgcaagacatgcgctacggcgaaaacccgcatcagcgcgccgcgttctaccgcgatatt
gaccccgccgcaggcagcctcgctgcatacaaacaactgcaaggcaaagaattgtcttac
aacaacatcgccgatgccgatgccgcatgggaagccgtcaaatccttcgacgtgcccgcc
tgcgtgattgtgaaacacgccaatccgtgcggcgtagccatcgcctccaataccttggat
gcctacaaactcgcctacgccaccgacaccaccagcgcgttcggcggcatcatcgctttc
aaccgcgaagttgacggcgcaaccgtcaaacaaattaccgacaaccagtttatggaagtc
ctcatggcgcctaagttcaccgccgaagccctcgaaatcgccgccgccaagaaaaacgtg
cgcgtattggaagtgccgcttgaggcaggcgcaaaccgcttcgaactcaaacgcgtcggc
ggcggactgttggtgcaaacgcccgacatccaccgcatcagccgcgccgatttgaaagtc
gtctccaaacgccaaccgaccgagcaggaatggaacgatttgctgttcgtctggaacgtc
gccaaatacgtcaaatccaacgccatcgtattcggcaaaggcggtcaaacctacggcatc
ggcgcaggccaaatgagccgcgtggacagcacccgcatcgccgcccgcaaagcgcaagat
gccggtctcgacctcaacggcgcgtgtgccgcatccgatgccttcttccccttccgcgac
ggcgtggacgtgattgccgaacagggcatcaaagccatcatccatccggcaggctcgatg
cgcgatcaggaagttttcgacgcagccgacgaacacggcatcgccatggtcgtaaccggc
atccgccatttccgccattga

DBGET integrated database retrieval system