KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1019Help
Entry
NMB1019           CDS       T00027                                 

Gene name
purK
Definition
(RefSeq) 5-(carboxyamino)imidazole ribonucleotide synthase
  KO
K01589  5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00230  Purine metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
Module
nme_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NMB1019 (purK)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.18  5-(carboxyamino)imidazole ribonucleotide synthase
     NMB1019 (purK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp PurK_C Dala_Dala_lig_C CPSase_L_D2 XdhC_C 2-Hacid_dh_C 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 903157
NCBI-ProteinID: NP_274053
UniProt: Q9JZJ9
Position
complement(1034247..1035383)
Genome map
AA seq 378 aa AA seqDB search
MKNISLSPPAMLGILGGGQLGRMFTVAAKTMGYKVTVLDPDPDAPAAEFADRHLCAPFND
QAALDELAKCAAVTTEFENVNADAMRFLAKHTNVSPSGDCVAIAQNRIQEKAWIRKAGLQ
TAPYQVVCKAEDITEASAQFLPGILKTATLGYDGKGQIRVKTLDELKAAFAEHGGVDCVL
EKMVDLRSEISVIVCRLNNDNVQTFDPAENIHENGILAYSIVPARLSADVQQQARQMAQR
LADELDYVGVLAVEMFVVGDTHELVVNEIAPRPHNSGHHTIDACAADQFQQQVRIMCNLP
PADTKLLSSCCMANILGDVWQEDGGEPDWLPLQSHPNAHLHLYGKKTAHKGRKMGHFTVL
TTDSDTAFQEAKKLHQSL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatatctctttctccgcccgccatgcttggcatcctcggcggcggacaatta
ggcagaatgtttaccgttgccgccaaaaccatgggctacaaagtaaccgttctcgacccc
gatccggacgcgccggcagcagaatttgccgaccgccatttgtgcgcgccgtttaacgac
caagctgctttggacgaattggcaaaatgcgcggcggtgaccactgaatttgaaaacgtc
aatgccgatgcgatgcgctttttggcaaaacataccaatgtttcccctagcggcgattgt
gtggcgattgcacaaaaccgcattcaggaaaaggcatggatacgcaaagcgggattgcaa
accgcgccgtatcaagtggtttgtaaggctgaagacatcactgaagcaagcgcgcaattt
ttgcccggcatcctgaaaacggctacgttgggctacgacggcaaaggtcaaatccgcgta
aaaacattggatgaactcaaagccgcgtttgccgaacacggcggcgtggattgcgttttg
gaaaaaatggtggatttgcgcagtgaaatttccgtaatcgtatgccgtttgaacaatgac
aacgtgcaaactttcgaccctgccgaaaacatccacgaaaacggcatcttggcttattcc
atcgtccccgcgcgactgagtgccgacgtgcagcaacaggcgcggcagatggcgcaacgc
ttggcggacgaattggattatgtcggcgtattggcggtagaaatgtttgttgtcggtgac
acgcatgaattggtcgtcaacgaaatcgccccgcgcccgcacaattccggacaccatacg
atagatgcctgcgcagcagaccagttccagcagcaggtacgcattatgtgcaacctgccg
cctgccgataccaaattactgagttcttgctgtatggcaaatattttgggcgacgtttgg
caggaagacggcggcgaaccggattggctgcccttgcaaagccatccgaatgcacacctg
cacctttacggcaaaaaaaccgcgcacaaagggcggaaaatgggacactttaccgtttta
accaccgattcggacaccgcatttcaagaagcaaaaaaactgcatcagtccctataa

DBGET integrated database retrieval system