KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1042
Entry
NMB1042           CDS       T00027                                 

Definition
(GenBank) cation transport ATPase, E1-E2 family
  KO
K01533  P-type Cu2+ transporter [EC:7.2.2.9]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NMB1042
Enzymes [BR:nme01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.9  P-type Cu2+ transporter
     NMB1042
Motif
Pfam: E1-E2_ATPase Hydrolase ATPase-cat_bd HMA Hydrolase_3
Other DBs
NCBI-ProteinID: AAF41440
UniProt: Q9JZI0
Position
1057346..1059817
AA seq 823 aa
MKKTCFHCGLDVPEHLHLTVRYENEDRETCCAGCQAVAQSIIDAGLGSYYKQRTADAQKT
ELPPQEILDQIRLYDLPEVQSDFVETHGGTREAVLMLGGITCAACVWLIEQQLLRTDGIV
RIDLNYSTHRCRVVWDDGKIRLSDILLKIRQIGYTAAPYDAQKIEAANQKERKQYIVRLA
VAGLGMMQTMMFALPTYLYGGDIEPDFLQILHWGGFLMVLPVVFYCAVPFYQGALRDLKN
RRVGMDTPITVAIIMTFIAGVYSLATNAGQGMYFESIAMLLFFLLGGRFMEHIARRKAGD
AAERLVKLIPAFCHHMPDYPDTQETCEAAVVKLKAGDIVLVKPGETIPVDGTVLEGSSAV
NESMLTGESLPVAKMPSEKVTAGTLNTQSPLIIRTDRTGGGTRLSHIVRLLDRALAQKPR
TAELAEQYASSFIFGELLLAVPVFIGWTLYADAHTALWITVALLVITCPCALSLATPTAL
AASTGTLAREGILIGGKQAIETLAQTTDIIFDKTGTLTQGKPAVRRISLLRGTDEAFVLA
VAQALEQQSEHPLARAILNCRISDGSVPDIAIKQRLNRIGEGVGAQLTVNGETQVWALGR
ASYVAEISGKEPQTEGGGSAVYLGSQSGFQAVFYLTDPLKDSAAEAVRQLAGKNLTLHIL
SGDRETAVAETARALGVAHYRAQAMPEDKLEYVKALQKEGKKVLMIGDGINDAPVLAQAD
VSAAAAGGTDIARDGADIVLLNEDLRTVAHLLDQARRTRHIIRQNLIWAGAYNIIAVPLA
VLGYVQPWIAALGMSFSSLAVLGNALRLHKRGKMQSEKMPSEQ
NT seq 2472 nt   +upstreamnt  +downstreamnt
atgaaaaaaacctgtttccactgcggtctggatgttcccgaacacctccacctgactgtc
cgttacgaaaacgaagaccgcgaaacctgctgcgccggctgtcaggcggtcgcacaaagc
attattgacgcgggcttgggcagttattacaaacaacgcaccgccgacgcgcaaaaaacc
gagctgccgccccaagaaatcctcgaccaaatccgcctgtacgacctgcccgaagtccag
tccgactttgtggaaacccacggcggcacgcgcgaggcggttttaatgctcggcggcatc
acctgcgccgcctgcgtctggctgatcgaacagcagcttttgcgtacagacggcatcgtc
cgcatcgacctcaattacagcacgcaccgctgccgcgtcgtctgggacgacggcaaaatc
cgcctttccgacattctgttgaaaatcaggcagataggctacaccgccgcaccctatgac
gcgcaaaaaatcgaagccgccaaccaaaaagaacgcaaacaatacatcgtccgcctcgcc
gttgccgggctggggatgatgcagacgatgatgttcgcgctgccgacctacctttacggc
ggcgacatcgaacccgatttcctgcaaatcctccattggggcggctttttaatggtgctg
cccgtcgtattctattgcgccgtcccgttttatcaaggcgcgctgcgcgacttgaaaaac
cgccgcgtcggcatggatacgccgattaccgtcgccatcatcatgacctttatcgccggc
gtttacagccttgcgacaaatgcggggcaggggatgtatttcgaatccatcgcgatgctg
ctgtttttcctgctgggcggacgctttatggaacacattgcccgccgtaaggcaggcgat
gccgccgagaggctggtgaagctgattcctgcgttttgccatcatatgcccgattacccc
gatacgcaggaaacctgcgaggcagctgtcgtcaaattgaaagcgggcgatatcgtgctg
gtcaaaccgggcgaaaccatccccgttgacggcacggtgctggaaggaagcagtgccgtc
aacgaatctatgctgaccggcgagagcctgcccgtcgccaaaatgccgtctgaaaaagta
accgccggcacactcaacacgcaaagccccctgattatacgcaccgaccgcaccggcggt
ggcacgcgactgtcgcacatcgtccgcctgctcgaccgcgccttagcgcaaaaaccgcgc
actgccgagttggcggaacaatacgcctcgtctttcatattcggcgaactcctgcttgcc
gtccccgtcttcatcggctggacgctgtacgccgacgcgcacaccgcattgtggattacc
gtcgccctgctggtcattacctgcccctgcgccttatcgcttgccacgccgaccgcgctg
gcagcttctaccggtacgctggcgcgcgaaggtattttaatcggcggaaagcaggcaatc
gaaaccctcgcccaaaccaccgacatcatcttcgacaaaaccggcacgctgacccaaggc
aaacccgccgtccgccgtatctcattgttgagaggcacagacgaagcctttgttctcgcg
gtggcgcaggctttagaacaacagtccgaacatccccttgcccgcgccatcctcaactgc
cgcatttcagacggcagcgtccccgacatcgctattaaacaacgcctcaaccgcatcggc
gaaggcgtgggcgcgcaactgaccgtcaacggcgaaacacaggtttgggcattgggcagg
gcatcctatgtcgccgaaatttcaggtaaagaaccgcaaacagaaggcggcggcagcgcg
gtttacctcggcagtcaaagcggtttccaagccgtgttctacctgaccgaccccttgaaa
gacagcgcggcggaggcggtgcggcagttggcaggcaaaaacctgaccctgcacatcctc
agcggcgaccgcgaaaccgccgttgccgaaaccgcacgcgccctgggtgtcgcgcactac
cgcgcccaagccatgcccgaggacaaactggaatacgtcaaagccttgcaaaaagaaggg
aaaaaagtgctgatgataggcgacggcatcaacgacgcgcccgttttggcgcaggcagac
gtatccgccgccgcagcgggcgggacggatattgcgagggacggcgcggacattgtgtta
ttgaacgaagatttgcgtaccgtcgcccacctgctcgatcaggcgcggcgcacccgccat
attatccggcaaaacctgatatgggcgggcgcgtacaatatcattgccgtaccgcttgcc
gttttgggctatgtccaaccgtggatagccgcactgggtatgagcttcagttcgctggcg
gttttgggcaacgccctgcgccttcacaaacgggggaaaatgcagtctgaaaaaatgccg
tccgaacaatga

DBGET integrated database retrieval system