KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1046Help
Entry
NMB1046           CDS       T00027                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00260  Glycine, serine and threonine metabolism
nme00750  Vitamin B6 metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01230  Biosynthesis of amino acids
Module
nme_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB1046 (thrC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NMB1046 (thrC)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NMB1046 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 903183
NCBI-ProteinID: NP_274080
UniProt: Q9JZH7
Position
complement(1062382..1063791)
Genome map
AA seq 469 aa AA seqDB search
MKYISTRGETAHKPFSEVLLMGLAPDGGLMLPEHYPQIGRETLDKWRGLAYPELAFEIMR
LFVTDIPEDDLRDILNRTYTEAAFGTKEITPVRTLSDGIKIQALSNGPTLAFKDMAMQFL
GNAFEYVLNKEGKKLNILGATSGDTGSAAEYALRGKKGVNVFMLSPDGKMSAFQRAQMYS
LQDENIHNIAVKGMFDDCQDIVKAVQNDAAFKEKYHIGTVNSINWGRIVAQVVYYFAGYF
NATSSNDETVSFCVPSGNFGNVCAGHIAKQMGLPIRRLIVATNENDVLDEFFKTGAYRPR
NSAHTYVTSSPSMDISKASNFERFVFDLMDRDPAEINTLWAEVAAGKGFDLRFALDKVGG
KYGFTSGKSTHADRLATIKQVYEQDQELIDPHTADGVKVAREVREEGEMVVCLETALAAK
FDATIREAVGDAAIPRPAALEGLENLPQRVQTVPNSADAVKGIIEQTLA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatcagcacgcgcggcgaaaccgcacacaaaccgttcagcgaagttttattg
atggggcttgcccccgacggcggcctgatgctgccggaacattatccgcaaatcgggcgc
gaaaccttggacaaatggcgcggtttagcttatcccgaattggcgtttgaaattatgcgc
ctgtttgttacggatattccggaggacgatttgcgcgacattctgaaccgtacttacacg
gaagcggcgttcggtactaaggaaatcacccccgtccgcacgctttcagacggcatcaaa
atccaagccttgtccaacggcccgacgctggcgttcaaagatatggcaatgcagtttttg
ggcaatgcgtttgaatatgttttaaacaaagaaggcaaaaaactcaatatcttgggcgcg
accagcggcgatacgggttcggctgcggaatatgccttgcgcggcaaaaagggcgtgaac
gtatttatgttgtcgcccgacggtaaaatgagcgcgttccaacgcgcgcaaatgtacagc
ctgcaagacgagaatatccacaatatcgccgtgaagggaatgtttgacgactgtcaggat
attgtgaaggcggtgcagaacgatgccgcgttcaaggaaaaataccatatcggtacggtc
aactcgatcaactggggacgcatcgtcgcgcaagtggtttattactttgcaggctatttc
aacgccacttcaagcaatgacgaaaccgtcagcttctgcgtaccgagcggcaacttcggc
aatgtttgcgcgggacacattgccaaacaaatgggcctgcctatccgccgcctgattgtc
gcgaccaatgaaaacgatgtgttggacgagtttttcaaaaccggtgcataccgcccgcgc
aacagcgcgcatacttatgtaacctccagcccgtctatggacatttccaaagcgtccaac
ttcgagcgtttcgtgttcgacctgatggatcgcgatcctgcggaaatcaatacgctgtgg
gcggaagtggctgcaggcaaaggctttgacctgcgatttgccttggacaaagtcggtggc
aaatacggttttacctctggcaaatccacccacgccgaccgcctcgccaccatcaagcag
gtttacgagcaagaccaagaactcatcgacccgcacactgccgacggcgtaaaagtcgcc
cgcgaagtgcgcgaagaaggtgaaatggtggtttgtttggaaaccgcgttggcggcgaaa
ttcgatgcgaccatacgcgaagccgtcggcgatgccgccattccgcgccctgccgcgctg
gaaggtttggaaaacctgccgcagcgcgtgcaaaccgtgccgaacagtgcggatgcggta
aaaggcatcatcgaacaaacccttgcctga

DBGET integrated database retrieval system