KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1055Help
Entry
NMB1055           CDS       T00027                                 

Gene name
glyA
Definition
(RefSeq) serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00260  Glycine, serine and threonine metabolism
nme00460  Cyanoamino acid metabolism
nme00630  Glyoxylate and dicarboxylate metabolism
nme00670  One carbon pool by folate
nme00680  Methane metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
nme01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NMB1055 (glyA)
  09102 Energy metabolism
   00680 Methane metabolism
    NMB1055 (glyA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB1055 (glyA)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    NMB1055 (glyA)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NMB1055 (glyA)
Enzymes [BR:nme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     NMB1055 (glyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHMT Aminotran_1_2 Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 903374
NCBI-ProteinID: NP_274089
UniProt: P56990
Position
complement(1074262..1075512)
Genome map
AA seq 416 aa AA seqDB search
MFSKSVTLAQYDPDLAAAIAQEDQRQQDHVELIASENYVSCAVMDAQGSQLTNKYAEGYP
GKRYYGGCEYVDIVEQLAIDRVKELFGAAYANVQPHSGSQANQAVYASVLKPGDTILGMS
LAHGGHLTHGASVNISGKLYNAVTYGLDENEVLDYAEVERLALEHKPKMIVAGASAYALQ
IDWAKFREIADKVGAYLFVDMAHYAGLVAGGEYPNPVPFCDFVTTTTHKTLRGPRGGVIL
CRDNTHEKALNSSIFPSLQGGPLMHVIAAKAVAFKEALQPEFKQYAKQVKINAAAMAEEL
VKRGLRIVSGRTESHVFLVDLQPMKITGKAAEAALGKAHITVNKNAIPNDPEKPFVTSGI
RIGSAAMTTRGFNEADARVLANLVADVLSNPEDEANLAKVRKQVTALCNKYPVYGA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaaaaagcgttaccctcgcacaatacgaccccgatttggcagcagccattgcc
caagaagaccaacgccagcaagaccacgtcgagctgattgcttccgaaaactacgtcagc
tgcgccgtaatggacgcgcaaggttcccagctgaccaacaaatacgccgaaggctacccc
ggcaaacgctactacggcggctgcgaatacgtcgatattgtcgaacaattggcgattgac
cgcgtaaaagaactgtttggcgcagcctatgccaacgtccaaccgcactccggctcgcaa
gccaaccaagccgtgtacgcttccgttttaaaaccaggcgacaccattttgggtatgtct
ctagcgcacggcggccacctgacccacggcgcgagcgttaatatctcaggcaaactctac
aacgccgttacttatggtttggatgaaaacgaagtgctcgattatgccgaagtcgaacgc
ctcgcgctcgaacacaaacccaaaatgattgtggcgggtgcgtctgcctacgcgttacaa
atcgactgggcaaaattccgcgaaatcgccgataaagtcggcgcatacctctttgtcgat
atggcgcactatgccggtctggttgccggcggcgaatatcccaacccggtgccgttctgc
gacttcgtgaccaccaccacccacaaaaccctgcgcggtcctcgcggcggcgtaattttg
tgccgcgacaatacccacgaaaaagcgttgaactcttccatcttcccaagcctgcaaggc
ggtccgctgatgcacgttatcgccgccaaagccgtggcgtttaaagaagcattgcaaccc
gagttcaaacaatacgcaaaacaagtgaaaatcaatgcagccgccatggcggaagagttg
gttaaacgcggtttgcgcatcgtttccggccgcaccgaaagccacgttttcctcgttgac
ctgcaaccgatgaaaattaccggcaaagccgccgaagccgctttgggcaaagcgcacatc
accgtcaacaaaaacgccattccgaacgatccggaaaaacccttcgttacctccggcatc
cgcatcggctccgctgccatgaccacacgcggttttaacgaagccgacgcgcgcgtattg
gcgaacttggttgccgacgtattgtctaaccccgaagacgaagccaacctcgccaaagtc
cgcaaacaagtaactgctttgtgcaataaataccccgtttacggcgcgtaa

DBGET integrated database retrieval system