KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1057Help
Entry
NMB1057           CDS       T00027                                 

Gene name
ggt
Definition
(RefSeq) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00430  Taurine and hypotaurine metabolism
nme00460  Cyanoamino acid metabolism
nme00480  Glutathione metabolism
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NMB1057 (ggt)
   00460 Cyanoamino acid metabolism
    NMB1057 (ggt)
   00480 Glutathione metabolism
    NMB1057 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nme01002]
    NMB1057 (ggt)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     NMB1057 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione hydrolase
     NMB1057 (ggt)
Peptidases [BR:nme01002]
 Threonine Peptidases
  Family T3: gamma-glutamyltransferase family
   NMB1057 (ggt)
CD molecules [BR:nme04090]
 Proteins
  NMB1057 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 903474
NCBI-ProteinID: NP_274091
UniProt: Q9JZH2
Position
complement(1075994..1077814)
Genome map
AA seq 606 aa AA seqDB search
MPCMNHQSNSGEGVLVAKTYLLTALIMSMTISGCQVIHANQGKVNTHSAVITGADAHTPE
HATGLTEQKQVIASDFMVASANPLATQAGYDILKQGGSAADAMVAVQTTLSLVEPQSSGL
GGGAFVLYWDNTAKTLTTFDGRETAPMRATPELFLDKDGQPLKFMEAVVGGRSVGTPAIP
KLMETIHQRYGVLPWGKLFDTPIRLAKQGFEVSPRLAISVEQNQQHLARYPKTAAYFLPN
GVPLQAGSLLKNLEFADSVQALAAQGAKALHTGKYAQNIVSVVQNAKDNPGQLSLQDLSD
YQVVERPPVCVTYRIYEVCGMGAPSSGGIAVGQILGILNEFSPNQVGYDAEGLRLLGDAS
RLAFADRDVYLGDPDFVPVPIRQLISKDYLKHRSQLLEQSDKALPSVSAGDFIHEWVSSQ
AIELPSTSHISIVDKAGNVLSMTTSIENAFGSTLMANGYLLNNELTDFSFEPIKQGKQVA
NRVEPGKRPRSSMAPTIVFKAGKPYMAIGSPGGSRIIGYVAKTIVAHSDWNMDIQNAISA
PNLLNRFGSYELETGTTAVQWQQALNDLGYKTDVRELNSGVQAIIIEPSRLVGGADPRRE
GRVMGD
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgccttgtatgaatcatcaatcaaactcaggcgaaggagtgcttgtggctaaaacatat
ttattgactgcattgataatgtctatgacaatctctggatgtcaagtcatccatgccaat
caaggtaaggttaatactcattctgctgtcatcacaggtgcagacgctcacacgcctgaa
catgcaacgggactgaccgaacaaaagcaggtgattgcaagtgattttatggtagcgtca
gccaatccattagcaacacaagctggctatgatatcttaaagcaaggcggtagcgctgca
gatgcgatggtggcggtgcagacgacactaagcttggtagagccacagtcgtcaggcttg
ggcggtggtgcatttgtgttgtattgggataataccgccaaaacattgaccacatttgat
gggcgtgagacggcaccgatgcgtgcgacgccggaattatttttggataaagatggtcaa
ccattgaaatttatggaagcggtggtcggtggtcgctcggtgggtacgcctgctatccct
aaactgatggagacaatacatcagcgatacggtgtattgccttggggaaaattatttgat
acaccgatccgcttggcaaaacaaggctttgaggtgtcgccaaggcttgccatctcggtt
gagcaaaatcagcagcatttggcacgctatccaaaaacagccgcttattttttgccgaat
ggtgtgccgctacaagcaggcagcttgctgaaaaatttagaatttgctgacagtgttcag
gcgttagcagctcaaggtgcaaaagctctgcatactggtaaatatgcccaaaatatcgtt
tcagttgtccaaaatgctaaggataaccccggtcaattatccttacaagatttatctgat
tatcaagtggtggaacgcccgcctgtttgtgtgacttatcgtatttatgaagtatgcggt
atgggtgcaccaagctcaggtgggattgctgtgggtcagattttggggattttaaatgaa
ttttcacccaatcaggtggggtatgatgctgaaggtttacgtctcttgggcgacgcttct
aggcttgcgtttgcggatcgtgatgtatatttgggcgaccctgattttgtaccagtaccc
attcgccagttgatttctaaagactacctaaaacatcgcagccagctgcttgagcagtcg
gataaggcattgcctagcgtatctgcaggcgattttattcatgagtgggtgtcctcacaa
gcgattgagttaccttctaccagtcatatatcaattgtggataaggcgggcaatgtgcta
tcaatgacgacttccattgaaaatgcgtttggctcaactttgatggcaaatggctacctg
ctgaataatgagctgacagactttagttttgagccaataaagcagggcaaacaggtcgcc
aatcgtgtcgagcccggcaagagaccacgctcctcaatggcaccaaccatcgtatttaaa
gcaggcaagccttatatggcaatcggctccccaggtggtagccgtatcattggctatgtc
gctaagacgattgtggcacatagtgactggaatatggatatccaaaatgccatcagtgca
cccaatttattaaatcgctttggtagctatgaactagaaacgggtacaaccgccgtccag
tggcaacaagcattaaatgatttgggctataagactgatgtgcgtgagctaaattcaggt
gttcaagccattattatcgagccaagcaggctggttggtggtgccgatccacgccgagaa
ggtcgagtgatgggtgattag

DBGET integrated database retrieval system