KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1060Help
Entry
NMB1060           CDS       T00027                                 

Gene name
fbp
Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00010  Glycolysis / Gluconeogenesis
nme00030  Pentose phosphate pathway
nme00051  Fructose and mannose metabolism
nme00680  Methane metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB1060 (fbp)
   00030 Pentose phosphate pathway
    NMB1060 (fbp)
   00051 Fructose and mannose metabolism
    NMB1060 (fbp)
  09102 Energy metabolism
   00680 Methane metabolism
    NMB1060 (fbp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nme04147]
    NMB1060 (fbp)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     NMB1060 (fbp)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NMB1060 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase NdhM Flg_bb_rod
Motif
Other DBs
NCBI-GeneID: 903477
NCBI-ProteinID: NP_274093
UniProt: Q9JZH1
Position
complement(1078904..1079878)
Genome map
AA seq 324 aa AA seqDB search
MDTLTRFLPEHLQQNQLPEALGGVLLSVVSACTEINAKVRLGALAGVLGMAGTGNIQGED
QKKLDVIANNIMIDTLKANSAVAGLASEEEDTFVNAGENGRYLVLFDPLDGSSNIDVNIS
VGTIFSILEKPEGALATESFLQTGRQQLAAGYVLYGPQTQLVFTFGHGVYMFTLNAENEF
VLTKENPKVPESTKEFAINMSNRRHWLPPVQQYIDELLAGETGTRGKNYNMRWVASMVAE
IHRILMRGGVFMYPQDKRDPAKPGKLRLMYEANPMSLILEQAGASASNAYQAMLDIQPEN
LHQRVAVFMGSSEEVAYLDRLHAK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggacacactgacccgattcctccccgaacacctgcaacaaaaccagctgcccgaagca
ctcggcggcgttttactgtccgttgtttccgcctgcaccgaaatcaacgccaaagtccgc
ctcggcgcactggccggcgtattgggtatggcgggcacgggcaatattcagggcgaagac
caaaaaaaactggatgttatcgccaacaacatcatgattgacacactcaaagccaattct
gccgttgccgggctggcgagcgaggaagaagacactttcgtaaatgccggtgaaaacgga
cgctatctcgtcctattcgaccctttagacggatcgtccaatattgatgtcaacatttcc
gtcggtacgattttctccatccttgaaaaacccgaaggcgcattggcaaccgaatcattc
cttcaaacgggcagacagcagcttgccgctggttacgttctttacgggcctcaaacccag
ctcgtattcacattcggacatggcgtatatatgttcacgctcaatgccgaaaacgaattt
gtgctgaccaaagaaaacccgaaagtacccgaaagtaccaaagaatttgccatcaatatg
tccaaccgccgccactggctgccccccgtccaacaatacatcgacgagctcttggcgggc
gaaaccggtacgcgcggcaaaaactacaatatgcgctgggtagccagtatggttgccgaa
atccaccgcatcctgatgcgcggcggcgtgttcatgtatccgcaagacaaacgcgacccc
gctaaacccggcaaactgcgcctgatgtacgaagccaaccctatgagcctgatactcgaa
caggcgggcgcatcggcaagcaacgcatatcaagccatgctcgacatacagcccgaaaac
ctgcaccaacgcgtcgccgtcttcatgggcagcagcgaagaagtcgcctatctcgaccgc
ctgcacgcaaaatag

DBGET integrated database retrieval system