KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1068Help
Entry
NMB1068           CDS       T00027                                 

Gene name
proA
Definition
(RefSeq) gamma-glutamyl phosphate reductase
  KO
K00147  glutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00330  Arginine and proline metabolism
nme00332  Carbapenem biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Module
nme_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    NMB1068 (proA)
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NMB1068 (proA)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     NMB1068 (proA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 903486
NCBI-ProteinID: NP_274101
UniProt: Q9JZG3
Position
complement(1087646..1088908)
Genome map
AA seq 420 aa AA seqDB search
MSNTQKQLALAKAAKKSVNTADTEEKNRALLAMADSLEAATADILAANRQDLEAAAGNIP
ESMTDRLLLDGKRICAMADGIRAVAALPNPVGEILETSTLPNGLEIVKKRVAMGVIGIIY
ESRPNVTSDAAALALKSGSAVVLRSGKDAFQSARAIVAALKTGLAQTRIDPDALQLIEDT
GRESSYEMMRAKDYLDLLIPRGGAGLIRAVVENAVVPVIETGTGIVHIYIDKDADWDKAL
RIVYNAKTSRPSVCNSMEVLLVHEDIAADFLPKLERLLVRDRIEAGLPPIRFRLDPQAAR
HIGGEAAGADDFDTEFLDYILAVKTVASVEEAVWHIETHSTHHSDGIVTENRHAADYFTT
HIDSAAVYVNASTRFTDGGEFGLGCEMGISTQKLHARGPMGLKELTSYKYIVQGTGQVRE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacacacaaaaacagcttgcccttgccaaagcggcaaaaaaatccgtcaacacg
gcggatacggaagaaaaaaaccgcgcgctgcttgcgatggcggacagcttggaagcggcg
acggcagatattttggcggcaaaccgtcaagacttggaagccgcggcaggcaacattccc
gaaagcatgaccgaccgccttttgttggacggcaaacgcatttgcgcgatggcggacggc
atcagggcggttgccgcgctgcccaaccccgtgggcgaaatactggaaacctcgactttg
cccaacggcttggaaatcgtcaaaaagcgcgtggcgatgggcgttatcggcattatttac
gaaagccgcccgaacgttacttccgatgcggcggctttggcactgaaaagcggcagcgcg
gtcgtactccgcagcggcaaagatgcattccaatccgcacgcgccatcgttgccgccctg
aaaacggggttggcgcaaacccgcatcgaccccgacgcgctccaactgattgaagacacc
gggcgcgaaagcagttacgaaatgatgagggcgaaagattatctagacctgctgattccg
cgcggcggggcggggctgatacgggcggtggttgaaaatgccgtcgtgccggtcattgaa
acgggaacgggcattgtccacatttatatcgacaaggacgcggattgggacaaggcgctc
cgtatcgtgtacaacgccaaaaccagccgtccgtccgtgtgcaactcgatggaagtgctg
ctggtacatgaagacattgctgccgacttcctgcccaagctcgaacggctgttggttcgc
gaccgcatagaagccggactgccgcccatccgcttccgtttggatccgcaggcggcgcgg
catatcggcggcgaagcggcgggtgcagacgatttcgataccgagtttttagactacatc
ctcgctgtgaaaaccgtcgcttcggtcgaagaggcggtctggcacatcgaaacccacagc
acacaccattcagacggcatcgttaccgaaaaccgccacgctgcggactatttcacgact
catatcgattctgccgccgtgtatgtcaacgcgtccacgcgctttaccgacggcggcgaa
ttcggcttgggttgcgaaatgggcatctccacgcaaaaactccacgcccggggcccgatg
ggtttgaaagagctgacgagttacaaatacatcgtacaaggcacgggacaggtcagggaa
taa

DBGET integrated database retrieval system