KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1074Help
Entry
NMB1074           CDS       T00027                                 

Gene name
argB
Definition
(RefSeq) acetylglutamate kinase
  KO
K00930  acetylglutamate kinase [EC:2.7.2.8]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00220  Arginine biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01210  2-Oxocarboxylic acid metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    NMB1074 (argB)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.8  acetylglutamate kinase
     NMB1074 (argB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase DUF1489
Motif
Other DBs
NCBI-GeneID: 903493
NCBI-ProteinID: NP_274107
UniProt: Q9JZF7
Position
1095130..1096026
Genome map
AA seq 298 aa AA seqDB search
MESENIISAADKARILAEALPYIRRFSGSVAVIKYGGNAMTEPALKEGFARDVVLLKLVG
IHPVIVHGGGPQINAMLEKVGKKGEFVQGMRVTDKEAMDIVEMVLGGHVNKEIVSMINTY
GGHAVGVSGRDDHFIKAKKLLIDTPEQNGVDIGQVGTVESIDTGLVKGLIERGCIPVVAP
VGVGEKGEAFNINADLVAGKLAEELNAEKLLMMTNIAGVMDKTGNLLTKLTPKRIDELIA
DGTLYGGMLPKIASAVEAAVNGVKATHIIDGRLPNALLLEIFTDAGIGSMILGGGEDA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggagtctgaaaacattatttccgccgccgacaaggcgcgtatccttgccgaagcgctg
ccttacatccgccggttttccggttcggtcgccgtcatcaaatacggcggcaacgcgatg
accgaacctgccttgaaagaagggtttgcccgcgatgtcgtgctgctgaagctggtcggc
attcatcccgtcatcgttcacggcggcgggccgcagatcaatgcgatgcttgaaaaagtc
ggcaaaaagggtgagtttgtccaaggaatgcgcgttaccgacaaagaggcgatggatatt
gtcgaaatggtgttgggcgggcatgtcaataaagaaatcgtgtcgatgattaacacatat
ggcggacacgcggtcggcgtaagcggacgcgacgaccatttcattaaggcgaagaaactt
ttgatcgatacgcccgaacagaatggcgtggacatcggacaggtcggtacggtggaaagc
atcgataccggtttggttaaagggctgatagaacgtggctgcattcccgtcgtcgccccc
gtcggcgtaggtgaaaaaggcgaagcgttcaacatcaacgccgatttggtagcaggcaaa
ttggcggaagaattgaacgccgaaaaactcttgatgatgacgaatatcgccggtgtgatg
gacaaaacgggcaatctgctgaccaaactcacgccgaaacggattgatgaactgattgcc
gacggcacgctgtatggcggtatgctgccgaaaatcgcttctgcggtcgaagccgccgtc
aacggtgtgaaagccacgcatatcatcgacggcaggttgcccaacgcgcttttgctggaa
atctttaccgatgccggtatcggttcgatgattttgggcggtggggaagatgcctga

DBGET integrated database retrieval system