KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1155Help
Entry
NMB1155           CDS       T00027                                 

Gene name
cysH-1
Definition
(RefSeq) phosphoadenosine phosphosulfate reductase
  KO
K00390  phosphoadenosine phosphosulfate reductase [EC:1.8.4.8 1.8.4.10]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00920  Sulfur metabolism
nme01100  Metabolic pathways
nme01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    NMB1155 (cysH-1)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.8  phosphoadenylyl-sulfate reductase (thioredoxin)
     NMB1155 (cysH-1)
    1.8.4.10  adenylyl-sulfate reductase (thioredoxin)
     NMB1155 (cysH-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAPS_reduct
Motif
Other DBs
NCBI-GeneID: 903576
NCBI-ProteinID: NP_274183
UniProt: Q9JRT1
Position
complement(1163248..1163988)
Genome map
AA seq 246 aa AA seqDB search
METTLFKPALWQIPHIGSGGETALAEKTETLKQRLHRIVGSHRDARFASSLAAEDMVITD
LIAGENLNIGIFTLDTGLLHTETLNLLDRLGRAYPHLRIKRFRPVREDADRYVESKGRFA
FYDSVEARRECCRIRKTEPLNRAIAGADAWLTGQRREQSATRTELPFAEYDAGRGIGKYN
PIFDWSEHDVWAYILANNVPYNDLYRQGFPSIGCDPCTRPVKAGEDIRAGRWWWEGRNSK
ECGLHK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgacactgttcaaacccgccctgtggcagataccgcatatcggatccggcggc
gaaaccgcccttgcggaaaaaacggaaaccctcaaacaacgcctgcaccggattgtcggc
agccaccgggatgcacggtttgccagcagccttgcggcagaagatatggtgattaccgac
cttatcgccggcgaaaacctcaatatcggcatttttaccttggatacggggctgctccac
acggaaaccctgaacctgctggacaggctcggacgcgcatatccccatttgcggataaag
cgtttccggccggttcgagaagatgccgaccgttatgtggaaagcaaaggcaggtttgcc
ttttacgacagcgttgaagcgcgccgcgaatgctgccgcatccgaaaaaccgaaccgctc
aaccgcgccattgcaggcgcggacgcctggcttaccgggcaacgccgcgaacaatccgcc
acacgcacggaactgccgtttgccgaatacgatgccggacggggcatcggcaaatacaac
ccgattttcgactggtcggaacacgacgtgtgggcatacatcctcgccaacaatgtgcct
tacaacgatttgtaccggcaaggatttcccagcataggctgcgacccctgcacccgcccc
gtcaaggcgggcgaagacatccgcgccgggcggtggtggtgggaaggcagaaacagcaaa
gaatgcgggctgcacaaataa

DBGET integrated database retrieval system