KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1177Help
Entry
NMB1177           CDS       T00027                                 

Gene name
accA-2
Definition
(RefSeq) acetyl-CoA carboxylase carboxyl transferase subunit alpha
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00061  Fatty acid biosynthesis
nme00620  Pyruvate metabolism
nme00640  Propanoate metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
nme01212  Fatty acid metabolism
Module
nme_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMB1177 (accA-2)
   00640 Propanoate metabolism
    NMB1177 (accA-2)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NMB1177 (accA-2)
Enzymes [BR:nme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     NMB1177 (accA-2)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     NMB1177 (accA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans
Motif
Other DBs
NCBI-GeneID: 903597
NCBI-ProteinID: NP_274204
UniProt: Q9JRV8
Position
1178969..1179928
Genome map
AA seq 319 aa AA seqDB search
MKPVFLDFEQPIAELTNKIDELRFVQDESAVDISDEIHRLQKKSNDLTKSIFSKLTPAQI
SQVSRHPQRPYTLDYIEALFTDFEELHGDRHFADDYAIVGGLARFNGQSVMVVGHQKGRD
TKEKIRRNFGMPRPEGYRKALRLMKTAEKFGLPVMTFIDTPGAYPGIGAEERGQSEAIGK
NLYELTRLRVPVLCTVIGEGGSGGALAVALGDYVNMLQYSTYSVISPEGCASILWKTAEK
AADAAQALGITADRLQKLDLVDTVIKEPLGGAHRDFGQTMKNVKAVLEKQLHEAQSIPLA
DLLSRRFDRIMAYGKFSEQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgtttttttggattttgaacaacccatagccgaactgaccaacaaaatcgat
gagctgcgtttcgtccaagacgagtctgccgtcgatatttcggacgaaatacaccgtttg
cagaaaaaaagcaacgacctgaccaaatcgattttcagcaaactcacacccgcccaaatt
tcacaggtttcccggcatccgcagcgtccctatactttggattacattgaggcactgttt
accgattttgaagaactgcacggcgaccgccactttgccgacgattatgcgattgtcggc
ggattggcgcgtttcaacggacaaagcgtgatggtcgtcgggcatcagaaagggcgcgac
accaaagaaaaaatccgccgcaacttcggtatgccccgtcctgaaggctaccgcaaagcc
ctgcgcctgatgaagacggcagaaaaattcggcttgcccgtaatgacctttatcgatacg
ccgggcgcgtatcccggcatcggcgcggaagaacgcgggcagtcggaagccatcggcaaa
aacctgtacgaactgacgcgcctgcgcgttcctgttttgtgtaccgtcatcggcgaaggc
ggttcaggcggtgcgttggcggtcgccctaggcgattacgtcaatatgctgcaatactcg
acctattctgttatctcccccgaaggctgcgcgtctattttgtggaaaaccgccgaaaag
gcggcggatgcggctcaggctttgggcattactgctgaccgcctgcaaaagctggacttg
gtcgataccgtcatcaaagaaccattgggcggcgcgcatcgggatttcgggcaaaccatg
aaaaacgtaaaagccgttttggaaaaacaactgcacgaagcgcaaagcatcccgcttgcc
gatttgctttcgcgccgtttcgaccgcattatggcttacggcaaattttcggaacaataa

DBGET integrated database retrieval system