KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1188Help
Entry
NMB1188           CDS       T00027                                 

Gene name
ilvD-2
Definition
(RefSeq) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00290  Valine, leucine and isoleucine biosynthesis
nme00770  Pantothenate and CoA biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01210  2-Oxocarboxylic acid metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
nme_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    NMB1188 (ilvD-2)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NMB1188 (ilvD-2)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     NMB1188 (ilvD-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD NiFeSe_Hases
Motif
Other DBs
NCBI-GeneID: 903608
NCBI-ProteinID: NP_274214
UniProt: Q9JS61
Position
complement(1187359..1189218)
Genome map
AA seq 619 aa AA seqDB search
MPEYRSKTSTHGRNMAGARALWRATGVMETDFGKPIIAVANSFTQFVPGHVHLHNMGQLV
AREIEKAGAIAKEFNTIAIDDGIAMGHSGMLYSLPSRDLIADSIEYMVNAHCADALVCIS
NCDKITPGMLIAAMRLNIPTIFVSGGPMEAGKVIGVANIQPERRLDLIDAMIESADDNVS
NRQVEEVEQNACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSYLATHAGRKELFLEAGR
MIVEITKRYYEQNDETVLPRSIATKKAFENAMTMDIAMGGSTNTILHLLAVANEAGVDFK
MADIDRLSRVVPCICKTAPNNHDYYMEDVHRAGGIFAILKELDKAGKLHTDVHTIHAPTL
KDAIEQWDVTNPENTRAIERFKAAPGGVRTTQAFSQNRMWKTLDLDREKGCIRDVAHAYS
QDGGLAVLFGNIAERGCVVKTAGVDESILKFTGRARVFESQEDAVEGILGNQIVAGDIVI
IRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHASPEAAEGGA
IGLVHEGDTVEIDIPNRSIHLAISDEELAARRAEMEARGSKAWKPKNRDRYVSAALRAYG
AMATSADKGAVRDVAQIER
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaataccgctccaaaacctccacccacggccgcaatatggcgggcgcacgtgca
ttgtggcgcgccaccggcgtgatggaaaccgacttcggcaagcccatcatcgccgttgcc
aactccttcacccaattcgtgcccggccatgtccacctgcacaatatgggccagctggtt
gcccgcgaaatcgaaaaagccggcgcaatcgccaaagaattcaacaccatcgccatcgac
gacggcatcgctatgggacacagcggcatgctgtactccctgcccagccgcgatttgatt
gccgactctatcgaatatatggtcaacgcccactgcgccgacgcgctggtgtgcatttcc
aactgcgacaaaatcaccccgggcatgctgattgccgcgatgcgcctgaacatccccacc
atcttcgtctccggcggcccgatggaagcgggcaaggttatcggcgtggcaaacatccag
cccgaacgccgtttggacttgattgacgcgatgattgaatcggcggacgacaatgtcagc
aaccggcaagtcgaggaagtcgaacaaaacgcctgcccgacctgcggctcgtgttcgggt
atgtttacggcaaactcgatgaactgcctgaccgaagcactcggcctttccctgcccggc
aacggttcgtatttggcgacccacgccggccgcaaagaattgttcctcgaagccggccgt
atgattgtcgaaatcaccaaacgctattacgagcaaaacgatgaaaccgtgttaccgcgc
agcattgccaccaaaaaagcgtttgaaaacgctatgacgatggatattgcgatgggcggc
agcaccaataccattttgcacctgttggccgttgccaacgaagccggtgtcgatttcaaa
atggcagacatcgaccgcttaagccgcgtcgtgccctgcatctgcaaaaccgcacccaac
aaccacgactactatatggaagacgtgcatcgcgccggcggtatcttcgccatcctgaaa
gaactggacaaagcgggcaaactgcacaccgacgtgcacaccatccacgcgccgacgctg
aaagacgcgattgaacaatgggacgtgaccaatcccgaaaacacccgtgccatcgaacgc
ttcaaagccgcgccgggcggcgtacgcaccacccaagcgttctcgcaaaaccgtatgtgg
aaaaccctcgacctcgaccgcgaaaaaggctgtatccgcgacgtggcacacgcctactcg
caagacggcggtttggcggtcttgttcggcaacatcgccgagcgcggctgcgtggtaaaa
accgcaggcgtggacgagagcatcctcaaattcaccggccgcgcccgcgtgtttgaaagc
caagaagacgcagtagaaggcattttgggcaaccaaatcgtcgctggcgacatcgtcatc
atccgctacgaaggcccgaaaggcggcccgggcatgcaggaaatgctgtatccgacttcc
tacctgaaatctaaaggcctcggcaaagcctgcgctctcttaaccgacggacgcttctcc
ggcggcacatcaggtttgtccatcggacacgcctcgcccgaagcggcggaaggtggcgcg
atcggtttggtacacgaaggcgataccgtcgaaatcgacatccccaaccgcagcatccac
cttgccatttccgatgaagagcttgccgcacgccgtgccgaaatggaagcgcgcggcagc
aaagcatggaagcctaaaaaccgcgaccgctacgtctccgccgcattaagagcttacggc
gcgatggcgacttccgccgacaaaggcgcggtgcgcgacgtagcgcaaatcgaaagataa

DBGET integrated database retrieval system