KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1191Help
Entry
NMB1191           CDS       T00027                                 

Gene name
cysN-2
Definition
(RefSeq) sulfate adenylyltransferase subunit 1
  KO
K00956  sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00230  Purine metabolism
nme00261  Monobactam biosynthesis
nme00450  Selenocompound metabolism
nme00920  Sulfur metabolism
nme01100  Metabolic pathways
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    NMB1191 (cysN-2)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NMB1191 (cysN-2)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NMB1191 (cysN-2)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    NMB1191 (cysN-2)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     NMB1191 (cysN-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU MMR_HSR1 GTP_EFTU_D2 ATP_bind_1 SRPRB GTP_EFTU_D3 cobW Ras
Motif
Other DBs
NCBI-GeneID: 903611
NCBI-ProteinID: NP_274217
UniProt: Q9JRU7
Position
complement(1192998..1194284)
Genome map
AA seq 428 aa AA seqDB search
MTAQHQTPLRFITAGSVDDGKSTLIGRLLYDSKALLSDQIKTLESGKSKGLKEAIDFSIL
TDGLEAEREQGITIDVAYRYFSTAKRKFIIADTPGHEQYTRNMVTGASTASAAVVLVDAS
QLDFGAQPLQLLPQTKRHSAILRQLNCPHIVVAVNKMDLLDYSEDKFNAIVEAYRRLAEQ
LGLKDAHFVPMSALLGDNIVYPGGNMPWYKGEPLLSILETLPGADEVSRTADDFYFPVQL
VVRQDADKADDFRGYQGRIERGSVAVGQTVRIEPNGLTAEVSEIITPKGEVAQAFAGEAA
TLRLDRDIDVSRGDLFVDKNSPLAPQKHLEATLCWFDERPLNTARKYLLKHGTQTVPAKV
GEIESVLDVRTLEQEAGAESLKMNDIAKVRINLQKPVTATPYAENTAAGSFILIDEATYG
TVAAGMIL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacggcacaacaccaaaccccgctccgcttcattaccgccggcagcgtcgatgacggc
aaaagcaccctgatcggacgactgctctacgacagcaaagccctgctgtccgaccaaatc
aaaaccttggaatccggcaaaagcaaaggtttgaaagaagccatagacttctccatcctg
accgacggactggaagccgaacgcgaacagggcattacgatcgatgtggcataccgctat
ttttccacggcgaaacggaaattcatcatcgccgacacgccggggcacgaacaatacacg
cgcaatatggttacgggcgcaagcaccgcttcggcggcagtcgtgctggttgacgcatcc
caactggatttcggcgcgcagcccttgcagcttctgccgcagaccaaacgccattccgcc
atcctccgccaactcaactgcccgcatattgtggtggcggtcaacaaaatggacctgctg
gattacagcgaagacaaattcaacgccattgtggaggcataccgccgacttgccgaacag
ctcggtttgaaagacgcgcatttcgtaccgatgtccgcactcttgggcgacaacattgtt
taccccggcggcaatatgccttggtataaaggcgaacccttattgtccattttggaaacc
ctgccgggggcggacgaagtcagccgcaccgccgacgatttttatttccccgtgcaactg
gtcgtccgccaagatgccgacaaggccgatgatttccgaggctatcaggggcgcatcgaa
cgcggttcggtcgccgtcgggcaaaccgtccgcatcgaaccgaacgggctgaccgccgaa
gtgtccgaaatcatcacgccgaaaggggaagtggcgcaggcttttgccggcgaggcggca
accctccggctggaccgcgacatcgatgtttcgcgcggcgacctttttgtcgataaaaat
tccccgctcgccccgcaaaaacatctggaagccacgctttgctggtttgacgaacgtccg
ctcaacaccgcgcgcaaatacctgctcaagcacggcacgcaaaccgtgccggcaaaagtc
ggggaaattgaaagcgttttggatgtccgcacgctggaacaagaggccggcgcggaatcc
ttgaagatgaacgacatcgccaaagtccgcatcaaccttcaaaaacccgttacggcaacg
ccttatgcggaaaacaccgccgccggttcgtttatcctgatagacgaagcgacatacggc
actgttgcggcaggtatgattttatga

DBGET integrated database retrieval system