KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1228Help
Entry
NMB1228           CDS       T00027                                 

Gene name
metM
Definition
(RefSeq) homoserine dehydrogenase
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00260  Glycine, serine and threonine metabolism
nme00270  Cysteine and methionine metabolism
nme00300  Lysine biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Module
nme_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB1228 (metM)
   00270 Cysteine and methionine metabolism
    NMB1228 (metM)
   00300 Lysine biosynthesis
    NMB1228 (metM)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     NMB1228 (metM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homoserine_dh NAD_binding_3 ACT ACT_4 DXP_reductoisom
Motif
Other DBs
NCBI-GeneID: 903650
NCBI-ProteinID: NP_274252
UniProt: Q7DDD6
Position
1233183..1234490
Genome map
AA seq 435 aa AA seqDB search
MKPVNIGLLGLGTVGGGTAAVLRDNAEEISRRLGREIRISAVCDLSEEKARQTCPSAAFV
KDPFELVAREDVDVVVELFGGTGIAKDAVLKAIENGKHIVTANKKLLAEYGNEIFPLAEK
QNVIVQFEAAVAGGIPIIKALREGLAANRIKSIAGIINGTSNFILSEMREKGSAFADVLK
EAQALGYAEADPTFDIEGNDAGHKITIMSALAFGTPMNFSACYLEGISKLDSRDIKYAEE
LGYRIKLLGITRKTGKGIELRVHPTLIPESRLLANVNGVMNAVRVNADMVGETLYYGAGA
GALPTASAVVADIIDIARLVEADTAHRVPHLAFQPAQVQAQTILPMDEITSSYYLRVQAK
DEPGTLGQIAALLAQENVSIEALIQKGVIDQTTAEIVILTHSTVEKHIKSAIAAIEALDC
VEKPITMIRMESLHD
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaagccagtaaacatcggtcttttaggtttgggtacggtcggcggcggtacggctgcc
gtgttgcgggacaacgcggaggaaatttcccgtcgcttggggcgcgaaatccgtatttct
gccgtgtgcgatttgagtgaagaaaaagcccgacaaacctgcccgtccgcagcctttgtc
aaagatccgttcgaactggtcgcacgtgaagacgtcgatgtcgtcgtcgaattgttcggc
ggtaccggcattgccaaagatgcggtgttgaaagccattgaaaacggcaaacacatcgtt
accgccaacaaaaaactgctcgccgaatacggcaacgaaatcttcccgctggcggaaaaa
caaaacgtcatcgtccaatttgaagcggcagtagcgggcggtatcccaatcatcaaagcc
ctgcgcgaaggtttggcggcaaacaggattaaatccatcgccggcattattaacggcacc
agcaacttcatcctctccgaaatgcgcgaaaaaggcagcgcgtttgccgatgtactgaaa
gaagcgcaggcattgggttatgccgaagccgatccgaccttcgacatcgaaggcaacgat
gcgggccataaaatcaccatcatgagcgcactggcattcggcacgccgatgaacttttcc
gcctgctacctcgaaggcatcagcaaactcgacagccgcgacatcaaatacgccgaagaa
cttggctatcgcatcaaactgttgggcattacccgcaaaaccggcaaaggcatcgagctg
cgcgtccaccctaccctgattcccgaaagccgcctcttggcaaacgtcaacggcgtgatg
aacgccgtgcgcgtcaacgccgatatggttggcgaaaccttatattacggcgcgggcgcg
ggcgcattgccgaccgcttccgccgtggttgccgatatcatcgacatcgcccgcctggtt
gaagccgataccgcccaccgcgtaccgcatctggcgttccaacccgcgcaagtccaagcg
caaaccatcctgcctatggacgaaattaccagcagctactacctgcgcgtccaagccaaa
gacgaaccgggcacgctggggcaaatcgccgcgctgttggcacaagaaaacgtgtccatc
gaagcactgattcaaaaaggcgtgattgatcagaccactgccgaaatcgtgattctgacc
cacagcacggtcgaaaaacacatcaagtcggcaatcgcagccatcgaagcactggattgc
gtggaaaaaccgattaccatgatccgcatggaaagcctgcatgactga

DBGET integrated database retrieval system