KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1244Help
Entry
NMB1244           CDS       T00027                                 

Gene name
rpe
Definition
(RefSeq) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00030  Pentose phosphate pathway
nme00040  Pentose and glucuronate interconversions
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
nme_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMB1244 (rpe)
   00040 Pentose and glucuronate interconversions
    NMB1244 (rpe)
Enzymes [BR:nme01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     NMB1244 (rpe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim QRPTase_C His_biosynth TMP-TENI PcrB IMPDH
Motif
Other DBs
NCBI-GeneID: 903666
NCBI-ProteinID: NP_274268
UniProt: Q9JZ85
Position
complement(1250984..1251712)
Genome map
AA seq 242 aa AA seqDB search
MTTYRIAPSILSADFARLGEEVESVIAAGADLIHFDVMDNHYVPNLTFGPMVCAALKPYA
SVPIDVHLMVEPVDDLIQSFAKAGASIITFHPEASRHIDRSLSLIRDMGCQAGLVLNPAT
PVYLLENVLDRLDMVLLMSVNPGFGGQSFIPHTLEKIRRVRAMLDRYEAQSGRHIAIEVD
GGIKTDNIAAVARAGADTFVAGSAIFGKPDYKAVIDAMRAELEKSGRLNLAPMIEIEMPS
EN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactacttaccgtatcgcacccagcattttatcggcagactttgcccgcctcggagaa
gaggtggaaagcgtcattgcggcaggtgcagatctgatccattttgacgtgatggacaac
cattatgtgccgaacctgaccttcggccctatggtttgcgcggcgttgaagccttatgca
agcgtgccgattgatgtgcatctgatggtcgaacccgttgacgacctgattcagtcgttt
gccaaagcaggagcatcaatcatcacgttccatcccgaggcgagccgccatatcgaccgc
agcttgagcctgattcgtgatatgggctgtcaggcggggctggtgttgaatccggcaacg
cccgtatatctgttggaaaacgtattggacaggctggatatggttttgctgatgtcggtc
aaccccggattcggcggacaaagcttcatcccgcacacccttgaaaaaatccgccgggtg
cgggcgatgctggatcggtacgaagcacaaagcgggcggcacatcgccatcgaagtggac
ggcggcatcaaaaccgacaatattgccgccgttgcccgagctggtgcggatacctttgtt
gccggttctgcgattttcggcaaaccagactataaggcggtgattgatgcgatgagggcg
gaactggaaaaaagcggcaggctgaaccttgcgccaatgattgaaatagaaatgccgtct
gaaaattag

DBGET integrated database retrieval system