KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1274Help
Entry
NMB1274           CDS       T00027                                 

Definition
(RefSeq) hypothetical protein
  KO
K09795  uncharacterized protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    NMB1274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF459 Lipase_GDSL_2 Lipase_GDSL
Motif
Other DBs
NCBI-GeneID: 903696
NCBI-ProteinID: NP_274295
UniProt: Q9JZ63
Position
1283700..1284683
Genome map
AA seq 327 aa AA seqDB search
MKNFLSLFSSILMSALIAVWFSQNPINAYWQQTYHRNSPLEPLAAYGWWRSGAALQENAY
ALSDGIKAFLSGETPPTAQDGGSADMPSEAAASEAVPQTGETEWKQDTEAAAVRSGDKVF
FVGDSLMQGVAPFVQKSLKQQYGIESVNLSKQSTGLSYPSFFDWPKTIEETLQKHPEISV
LAVFLGPNDPWDFPVGKLYLKFASDEWAQEYLKRVDRILEAAHTHRVQVVWLGIPYMKKA
KLDGQMRYLDKLLSEHLKGKIILIPTTHTLSGGKDRYTDSVNVNGKPVRYRSKDGIHFTA
EGQKLLAAKIMEKIVFEPSTQPSSTQP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactttctttcccttttctcctccatactgatgtctgccctgattgccgtgtgg
ttcagccaaaaccccatcaacgcctactggcagcagacctaccaccgcaacagcccgctc
gaaccgcttgccgcctacggatggtggcggagcggtgcggcgttgcaagaaaacgcctac
gccctttcagacggcatcaaagccttcctgtccggcgaaacgccgccgacggctcaagac
ggcggttcggcagatatgccgtctgaagccgccgcatccgaagccgtccctcaaaccggt
gaaacagaatggaaacaagacaccgaagccgccgccgtccgcagcggcgacaaagtcttt
tttgtcggcgactcgctgatgcagggcgttgcccccttcgtgcaaaaaagcctgaaacag
caatacggcatcgaatccgtcaacctcagcaaacaaagcacggggctgtcctacccctca
ttcttcgactggccgaaaacgattgaagaaaccctgcaaaaacatcccgaaatcagcgta
ctcgccgtcttcctcggaccgaacgacccgtgggatttccccgtcggcaaactctatctc
aaattcgcttccgacgaatgggcgcaagaatacctgaaacgtgtcgaccgcatccttgaa
gccgcacacacgcaccgcgtccaagtcgtctggctcggcatcccctacatgaaaaaagcc
aagctcgacggacagatgcgctacctagacaaactgctttcggaacatttgaaaggcaaa
atcatcctgattcccaccacgcacaccctgagcggcgggaaagaccgctacaccgactcc
gtcaacgtcaacggcaaacccgtccgctaccgcagcaaggacggcatacactttaccgcc
gaaggacaaaaactgctggcggcaaaaataatggaaaaaatcgtttttgaaccaagtacg
caaccatcaagtacacagccatga

DBGET integrated database retrieval system