KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1283Help
Entry
NMB1283           CDS       T00027                                 

Gene name
kdsA
Definition
(RefSeq) 2-dehydro-3-deoxyphosphooctonate aldolase
  KO
K01627  2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC:2.5.1.55]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00540  Lipopolysaccharide biosynthesis
nme01100  Metabolic pathways
Module
nme_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB1283 (kdsA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:nme01005]
    NMB1283 (kdsA)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.55  3-deoxy-8-phosphooctulonate synthase
     NMB1283 (kdsA)
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Unusual sugar
  NMB1283 (kdsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 903705
NCBI-ProteinID: NP_274303
UniProt: Q9JZ55
Structure
PDB: 

Position
1299864..1300706
Genome map
AA seq 280 aa AA seqDB search
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANR
SSIHSYRGVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTD
LVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLG
FGVMKQTCGNLPVIFDVTHSLQTRDAGSAASGGRRAQALDLALAGMATRLAGLFLESHPD
PKLAKCDGPSALPLHLLEDFLIRIKALDDLIKSQPILTIE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggatattaaaatcaacgacatcaccctcggcaacaactcgcccttcgtcctattcggc
ggcatcaacgttttggaaagcttggattccaccctccaaacctgcgcgcattacgtcgaa
gttacccgaaaactcggtattccctatatctttaaagcctctttcgacaaggcaaaccgt
tcctccatccattcttatcgcggcgtaggcttggaagaaggcttaaagatttttgaaaaa
gtcaaagcagagttcggcatccccgtcattaccgacgtacacgaaccccatcagtgccaa
cccgtcgccgaagtgtgcgatgtcatccagcttcccgcctttcttgcgcggcagaccgat
ttagtggttgccatggcaaaaactggcaacgtcgtcaacatcaaaaaacctcagttcctc
agcccctctcaaatgaaaaacattgtggaaaaattccacgaagccggcaacgggaaactg
attttatgcgaacgcggcagcagcttcggctacgacaacctcgttgtcgatatgctcggt
ttcggcgtgatgaaacagacttgcggcaacctgccggttattttcgacgttacccattcc
ctgcaaacccgcgatgccggttctgccgcatccggcggtcgtcgcgcacaggctttggat
ttggcacttgcaggcatggcaacccgccttgccggtctgttcctcgaatcgcaccccgat
ccgaaactggcaaaatgcgacggccccagcgcgctgccgctgcaccttttagaagatttt
ttaatccgcatcaaagcattggacgatttaatcaaatcacaaccgattttaacaatcgag
taa

DBGET integrated database retrieval system