KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1285Help
Entry
NMB1285           CDS       T00027                                 

Gene name
eno
Definition
(RefSeq) phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00010  Glycolysis / Gluconeogenesis
nme00680  Methane metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
nme01230  Biosynthesis of amino acids
nme03018  RNA degradation
Module
nme_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB1285 (eno)
  09102 Energy metabolism
   00680 Methane metabolism
    NMB1285 (eno)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    NMB1285 (eno)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:nme03019]
    NMB1285 (eno)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nme04147]
    NMB1285 (eno)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     NMB1285 (eno)
Messenger RNA biogenesis [BR:nme03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     NMB1285 (eno)
Exosome [BR:nme04147]
 Exosomal proteins
  Proteins found in most exosomes
   NMB1285 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C Ribosomal_L37e
Motif
Other DBs
NCBI-GeneID: 903707
NCBI-ProteinID: NP_274305
UniProt: Q9JZ53
Position
1301209..1302495
Genome map
AA seq 428 aa AA seqDB search
MSAIVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYS
GKGVLKAVEHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVAR
AAAEDSGLPLYRYLGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMPVGAKSFREALR
CGAEIFHALKKLCDSKGFPTTVGDEGGFAPNLNSHKEALQLMVEATEAAGYKAGEDVLFA
LDCASSEFYKDGKYHLEAEGRSYTNAEFAEYLEGLVNEFPIISIEDGMDENDWEGWKLLT
EKLGGRVQLVGDDLFVTNPKILAEGIEKGVANALLVKVNQIGTLSETLKAVDLAKRNRYA
SVMSHRSGETEDSTIADLAVATNCMQIKTGSLSRSDRMAKYNQLLRIEEELAEAADYPSK
AAFYQLGK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaatcgttgatattttcgcccgcgaaattttggactcacgcggcaaccccaca
gtcgagtgtgatgtattgctcgaatccggcgtaatgggacgcgcagccgtaccgagcggc
gcgtccaccggtcaaaaagaggctttggaacttcgcgacggcgacaaatcccgttattcg
ggcaagggcgtattgaaggcggtcgaacacgtcaacaaccaaatcgcccaagccctcatt
ggtatcgatgccaacgagcaatcttatatcgaccaaatcatgatcgaattggacggtact
gaaaacaaaggcaatttgggtgcgaatgcgactttggcggtttctatggcggttgcacgc
gccgctgccgaagactcaggcctgccgctttaccgctacttgggcggcgcaggcccgatg
tccctgcccgtaccgatgatgaacgtcatcaacggcggcgaacacgccaacaacagcctg
aacatccaagagtttatgattatgcccgtcggcgcaaaatctttccgcgaagcgttgcgc
tgcggtgcggaaattttccacgccttgaaaaaactgtgcgacagcaaaggcttcccgacc
acagtcggcgacgaaggcggtttcgcccccaacctgaacagccacaaagaagccctgcaa
ctgatggtcgaggcgaccgaagccgccggctacaaagcgggcgaagacgtattattcgca
ttggactgcgcctccagcgagttctacaaagacggcaaataccacttggaagccgaaggc
cgctcctacaccaacgcggaatttgccgaatatctggaaggcctggtcaacgagttcccc
atcatctccatcgaagacggcatggatgaaaacgactgggaaggctggaaactgctgacc
gaaaaactgggcggtagagttcaattggttggcgacgacttgttcgtaaccaatccaaaa
atcttggccgaaggcatcgaaaaaggcgtagcaaacgcattgctggtcaaagtcaatcaa
atcggtactttgagcgagaccctgaaagccgtcgacttagccaaacgcaaccgctacgcc
agcgtaatgagccaccgctccggcgaaaccgaagacagcaccattgccgacttggcagtc
gccaccaactgtatgcagatcaaaaccggttctttgagccgttccgaccgcatggcgaaa
tacaaccaactgctgcgtatcgaggaagaattggcggaagccgccgactaccccagcaaa
gccgcattctaccaactgggcaaataa

DBGET integrated database retrieval system