KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1300Help
Entry
NMB1300           CDS       T00027                                 

Gene name
cmk
Definition
(RefSeq) cytidylate kinase
  KO
K00945  CMP/dCMP kinase [EC:2.7.4.25]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00240  Pyrimidine metabolism
nme01100  Metabolic pathways
Module
nme_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    NMB1300 (cmk)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.25  (d)CMP kinase
     NMB1300 (cmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytidylate_kin Cytidylate_kin2 AAA_17 AAA_18 ADK AAA_33
Motif
Other DBs
NCBI-GeneID: 903722
NCBI-ProteinID: NP_274319
UniProt: P57065
Position
1317739..1318395
Genome map
AA seq 218 aa AA seqDB search
MNRQKVIAIDGPGASGKGTVAARVAAALGYDYLDTGALYRLTALYAQKQGVGWHDEENVS
ELAKKLPAVFSGSRILLGGEDVSDGIRTEAIGMGASAVAQLPKVRAALLQRQRDFLTEKG
LVADGRDTGSVVFPQAELKIFLTAESKIRAERRAKQIGIPCEGLAFERILSDIEARDEAD
RNRKVAPLKQQPDALLLDTSRLTIEETVKKVLDWYREV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacagacaaaaagtcatcgccatcgacggcccgggcgcatcgggcaaaggcacggtt
gccgcccgcgttgccgccgcattgggatacgattatctcgataccggcgcactctaccgc
ctgactgccctatatgcacaaaaacaaggcgtgggatggcacgatgaagaaaacgtttcc
gaactggcaaaaaaactgcccgccgtattttcaggcagccgcatcctgctcggcggcgaa
gacgtttcagacggcatccggacagaagccatcggcatgggcgcatccgcagtcgcacag
ttgcctaaagtccgcgccgccctgctgcaacgccaacgcgattttctgaccgaaaaagga
ctggttgccgacggacgggacaccggatcggtcgtcttcccccaagccgaacttaaaatc
ttcctgacggcagaatccaaaatccgtgccgaacgccgcgccaaacaaatcggcatcccc
tgcgaaggtttggcattcgagcgcatcctgtccgacatcgaagccagagacgaggcagac
cgaaaccgcaaagttgcccccctgaaacaacagcccgatgccctgcttttggacacaagc
cgcctgactatagaagaaactgtaaaaaaagtgcttgattggtatcgtgaagtttaa

DBGET integrated database retrieval system