KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1304Help
Entry
NMB1304           CDS       T00027                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00010  Glycolysis / Gluconeogenesis
nme00071  Fatty acid degradation
nme00350  Tyrosine metabolism
nme00625  Chloroalkane and chloroalkene degradation
nme00626  Naphthalene degradation
nme00680  Methane metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
nme01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB1304
  09102 Energy metabolism
   00680 Methane metabolism
    NMB1304
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NMB1304
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    NMB1304
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NMB1304
   00626 Naphthalene degradation
    NMB1304
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NMB1304
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     NMB1304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N MinC_C 2-Hacid_dh_C Met_10
Motif
Other DBs
NCBI-GeneID: 903726
NCBI-ProteinID: NP_274323
UniProt: Q7DDC8
Position
1321440..1322576
Genome map
AA seq 378 aa AA seqDB search
MEMKQADSTIKSRAAVAFAPNQPLQIVEIDVEMPRKGEVLIRNTHTGVCHTDAFTLSGSD
PEGVFPVVLGHEGAGVVVAVGEGVSSVKPGDHVIPLYTAECGECEFCCSGKTNLCVSVRD
TQGKGLMPDGTTRFSYQGQPIYHYMGCSTFSEYSVVAEVSLAKINPEANHEQVCLLGCGV
TTGIGAVHNTAKVQEGDSVAVFGLGAIGLAVVQGARQAKAGRIIAIDTNPSKFELAKQFG
ATDCLNPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRQALESAHRGWGQSIIIGVAG
AGQEISTRPFQLVTGRVWKGSAFGGVKGRSELPKMVEDSMKGDIELEPFVTHTMTLDQIN
KAFDLMHEGKSIRAVIHY
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgaaacaagccgattcaaccatcaaatctcgtgcggcggtggcattcgcccct
aaccaacccttacaaattgtggaaatcgacgtagaaatgccgcgtaaaggcgaggtgtta
atccgcaatacccacactggcgtgtgccatactgatgcgtttacgttatcaggaagcgat
cctgaaggcgtattccctgtggtgcttggacacgaaggtgcgggtgtggtcgttgctgtg
ggcgaaggtgtgtcaagcgtaaaaccgggtgatcacgtgattccgctttacaccgccgaa
tgtggcgaatgtgagttttgttgttcaggtaaaaccaacttgtgcgtctcagtgcgtgat
acacaaggtaaaggcttaatgccggacggcacgacgcgtttttcttatcaaggtcagcca
atctatcactatatgggctgttcgactttcagtgaatactccgttgttgccgaagtttca
ctggcgaaaatcaaccctgaagccaaccatgaacaagtatgtttgctcggctgcggcgtt
accacaggtattggtgcggtacataatacggcaaaagtgcaagaaggcgactctgttgcc
gtgtttggtttgggggcgattggtttggcggtggtgcaaggtgcgcgtcaagccaaagcc
ggccgcattatcgccattgataccaatccatcaaaatttgagttggcaaaacagttcggt
gcaacggattgtttgaacccgaacgattacgataaaccgatcaaagatgtgttgttagac
attaataaatggggcattgaccatacctttgaatgtatcggcaatgtaaacgtaatgcgt
caggcattagaaagtgcacatcgtggttggggtcaatccattatcatcggcgtagcaggt
gcaggacaagaaatttcaacgcgtccgttccagttggtaacaggtcgtgtttggaaaggt
tcagcatttggcggtgtgaaaggtcgctctgaactgccgaaaatggtggaagattcaatg
aaaggcgacattgagttagaaccgtttgtaacccacacaatgacactcgatcaaatcaat
aaagcctttgacttaatgcacgaaggtaaatcgatccgcgccgttattcactactaa

DBGET integrated database retrieval system