KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1305Help
Entry
NMB1305           CDS       T00027                                 

Definition
(RefSeq) esterase D
  KO
K01070  S-formylglutathione hydrolase [EC:3.1.2.12]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00680  Methane metabolism
nme01120  Microbial metabolism in diverse environments
nme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    NMB1305
Enzymes [BR:nme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.12  S-formylglutathione hydrolase
     NMB1305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Esterase Hydrolase_4 Chlorophyllase2 Peptidase_S9 Lipase_3 DLH Abhydrolase_6 Abhydrolase_3 Chlorophyllase PGAP1 Abhydrolase_1
Motif
Other DBs
NCBI-GeneID: 903727
NCBI-ProteinID: NP_274324
UniProt: Q9JZ43
Structure
PDB: 

Position
1322585..1323412
Genome map
AA seq 275 aa AA seqDB search
MKLIEQHQIFGGSQQVWAHHAQTLQCEMKFAVYLPNNPENRPLGVIYWLSGLTCTEQNFI
TKSGFQRYAAEHQVIVVAPDTSPRGEQVPNDDAYDLGQSAGFYLNATEQPWAANYQMYDY
ILNELPRLIEKHFPTNGKRSIMGHSMGGHGALVLALRNQERYQSVSAFSPILSPSLVPWG
EKAFTAYLGKDREKWQQYDANSLIQQGYKVQGMRIDQGLEDEFLPTQLRTEDFIETCRAA
NQPVDVRFHKGYDHSYYFIASFIGEHIAYHAAFLK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgattgaacaacatcaaatttttggtggttcgcaacaagtttgggcgcatcat
gcccaaacgctgcaatgcgaaatgaaatttgccgtctatttgccaaataatccagaaaat
cgaccgcttggtgtgatttattggctttccggcttgacgtgtacggaacaaaatttcatt
accaagtcaggctttcagcgttatgcggcagaacatcaagtaattgtggtggcccccgat
accagccctcgcggagagcaagtgccgaacgatgatgcttacgatttaggacagagtgca
ggcttttatttgaatgcgaccgaacagccttgggcggcgaattatcaaatgtatgattac
attttgaacgagctgccccgtctgattgagaaacactttcctaccaacggcaaacgttcc
attatgggacattcaatgggcggacacggcgcattggtattggcgctgcggaatcaggaa
cgttatcaaagtgtttctgccttttcgcctattttatcgccaagcctcgtgccgtgggga
gaaaaagcctttactgcttatttagggaaagaccgtgaaaaatggcagcaatatgatgct
aactcactcattcaacaaggctataaagtgcaaggtatgcgcatcgatcaaggcttggaa
gatgagtttttgccgacacaattgcgtaccgaagattttatcgaaacctgccgtgcggca
aaccagccggtcgatgtgcgtttccataaaggctacgatcacagctattacttcatcgcc
agttttattggcgagcatattgcttatcacgccgcgtttttgaagtaa

DBGET integrated database retrieval system