KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1307Help
Entry
NMB1307           CDS       T00027                                 

Gene name
ndk
Definition
(RefSeq) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00230  Purine metabolism
nme00240  Pyrimidine metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
Module
nme_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
nme_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
nme_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NMB1307 (ndk)
   00240 Pyrimidine metabolism
    NMB1307 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nme04131]
    NMB1307 (ndk)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     NMB1307 (ndk)
Membrane trafficking [BR:nme04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    NMB1307 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 903729
NCBI-ProteinID: NP_274326
UniProt: P65533
Position
1325013..1325438
Genome map
AA seq 141 aa AA seqDB search
MAIERTISIIKPDAVGKNVIGKIYSRFEENGLKIVAAKMKQLTLKEAQEFYAVHKDRPFY
AGLVEFMTGGPVMIQVLEGENAVLKNRELMGATNPSEAAEGTIRADFATSVSINAVHGSD
SVENAALEIAYFFSQTEICPR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgaacgtaccatctccatcatcaaacccgatgccgtcggcaaaaatgttatc
ggcaaaatatacagccgctttgaggagaacggtctgaaaatcgttgccgccaaaatgaag
cagcttactctcaaagaggcgcaagaattttatgcggttcataaagaccgccccttctac
gccggattggttgaatttatgaccggcggtccggttatgattcaggtattagagggtgaa
aacgccgtcctgaaaaaccgcgaactgatgggtgcaactaatccttccgaagccgccgaa
ggcacgatacgcgcggactttgccacttcggtcagcattaatgccgtacacggttccgac
agcgtggaaaatgccgctttggaaattgcctactttttcagccaaaccgaaatctgcccc
cgttga

DBGET integrated database retrieval system