KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1318Help
Entry
NMB1318           CDS       T00027                                 

Gene name
pssA
Definition
(RefSeq) CDP-diacylglycerol--serine O-phosphatidyltransferase
  KO
K17103  CDP-diacylglycerol---serine O-phosphatidyltransferase [EC:2.7.8.8]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00260  Glycine, serine and threonine metabolism
nme00564  Glycerophospholipid metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
Module
nme_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NMB1318 (pssA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB1318 (pssA)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.8  CDP-diacylglycerol---serine O-phosphatidyltransferase
     NMB1318 (pssA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-GeneID: 903740
NCBI-ProteinID: NP_274337
UniProt: Q7DDC6
Position
1336381..1337127
Genome map
AA seq 248 aa AA seqDB search
METPTNTPQRSLRQNSIYLLPNSFTIAALFSAFYAITQSMHGRYETAAIAVFISMLLDGM
DGRVARLTNSQSAFGEQLDSLADMVSFGVAPALIAYKWQLWQFGKIGYSVAFIYCACAAL
RLALFNTLIGKVDKRWFIGVPSPTAAALIVGLIWVNHSVEKFPAVHWWALGITLFAGLSM
IVQIPFWSFKEINIRRQVPFVGMLLAVLLLLLVTWEPSLVLFLFFLGYSLSGYIMAARRF
WKKYRKAD
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccccgaccaacaccccgcaacgctccctgcgtcaaaacagtatctacctgctg
cccaattcctttactatcgccgcgctgttttccgcgttttacgcaatcacccaatccatg
cacggacgttatgaaaccgccgccatcgcggtattcatctctatgttgctggacggtatg
gacgggcgcgtggcgcggctgaccaacagccaaagcgcgttcggggagcagctcgacagc
cttgccgatatggtcagcttcggcgttgctcccgctctgattgcctacaaatggcagctt
tggcagttcggcaaaatcggttattccgtcgccttcatctactgcgcctgcgccgccctg
cgcctcgccctgttcaacacactcatcggcaaggtggacaaacgctggtttatcggcgtg
cccagtccgactgccgccgcgctgattgtcgggctgatttgggtcaaccacagcgtcgaa
aaattccccgccgtccactggtgggcattgggcatcacactgtttgccggcctgtcgatg
attgtccaaatccctttttggagttttaaagaaatcaacatccgcagacaagtccccttt
gtcggaatgctgcttgccgtcttactgctgcttctggtcacttgggaaccgtcgctcgtc
ctcttcctgttctttctcggatacagcctgtccggctacattatggcggcacgccgattt
tggaaaaagtacagaaaggcggattaa

DBGET integrated database retrieval system